KEGG   Maylandia zebra (zebra mbuna): 101485471Help
Entry
101485471         CDS       T02814                                 

Gene name
hdac11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101485471 (hdac11)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     101485471 (hdac11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 367 aa AA seqDB search
MSHKEDNEEKRRCHRTDLYASIPRTCLPIVYHPDYNITFMGLEKLHPFDAGKWGKVIRFL
KEEQFINDGNLVEAREAAEEDLLIVHTKRYLNRLKWSLVVATITEIPPLLFLPNFLVQRK
VLRPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERV
EGISRVTIIDLDAHQGNGHERDFLDDRRVFIMDMYNRYIYPGDEYAKRAIKRKVELDWGT
EDSEYLQKVELHMEGTLNEVLPDIIVYNAGTDILDGDPLGGLSISPQGIIKRDELVFRAA
KRRGIPVLMMTSGGYQKKTARIIADSILNLHRQGLIEGNAAEGEGSTLLTTHMTPTSGSA
GSTSTAV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacaaagaagataacgaggagaagaggcgctgccaccgcactgatttgtatgcc
agcatccctcgaacatgtctgcctattgtgtaccacccagactacaacatcacttttatg
ggccttgaaaagcttcacccgtttgatgcgggaaagtgggggaaagtcatccgcttcttg
aaagaggagcagtttatcaatgatgggaaccttgtggaagctcgtgaagctgctgaggag
gatctgctgatcgttcacaccaaacgctacctcaacagattaaagtggtctctggtggtg
gcaaccatcacagaaattccacctctcctgtttctgcctaatttcctggtgcagcggaag
gtgctaaggcctttgcggactcagacagggggaacaataatggcaggaaaacttgctgtt
gagcgagggtgggccataaacgtaggaggaggcttccaccactgctccagcgacagagga
ggtggattttgtgcctatgctgacatcactttggccatcaagtttctgtttgagagagtc
gaaggcatctccagggtgaccatcatcgatctggatgctcatcagggaaatggacacgag
cgtgactttctggacgacaggcgagtgttcatcatggatatgtacaatcgctacatttat
cctggagacgaatatgccaaaagagcaataaaaaggaaggtggagctggactggggcacg
gaagactcagagtaccttcagaaggttgagctccacatggagggaacactgaatgaggtc
ttgcctgatatcatcgtttataatgcagggacagacatcttggatggggacccacttggg
ggactctcaatatcaccacagggcattataaagagagatgagctcgtgttcagggctgcg
aagcgtcgggggatccccgtactcatgatgacatccggaggatatcagaagaaaacagcc
cgcataattgcagactccatcctcaacctgcaccggcaaggtctaatagaaggcaacgcg
gcggaaggagagggatcgacactgctgacgacccacatgacgcccacctctggatcggca
gggtcaacatccacagctgtctga

DBGET integrated database retrieval system