KEGG   Maylandia zebra (zebra mbuna): 101485919Help
Entry
101485919         CDS       T02814                                 

Definition
(RefSeq) serine protease 27-like
  KO
K09628  
serine protease 27 [EC:3.4.21.-]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101485919
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101485919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 290 aa AA seqDB search
MAFYKVMCLAAGLMLLTQESESQLNVCGQPKLNTKIVGGQAARAGSWPWQVSLQRSGSHF
CGGSLINSQWVLTAAHCFQTTNLRGLTVNLGRQSLQGSNPNAVSRTVTKIIKHPKYNSGT
YDNDICLLQLSSPVTFNNYISPVCLAASNSIFYSGVNSWVTGWGSTREGASAPSPNLMEV
EVPVVGNRKCNCNYRVGSITDNMICAGLSAGGKDSCQGDSGGPMVSKQSGRWIQAGVVSF
GEGCARPNLPGVYARVSQYQTWIRTQISSNQPGFMTFTSTGTNSDLSVTC
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctttctacaaagtgatgtgtttggctgctgggctgatgctcctgacccaagagtct
gagtcacagctgaatgtttgtggtcagccaaagctcaacaccaagattgtaggaggacag
gcggcccgcgctggcagctggccctggcaggtcagtctgcaaagatctgggtcccacttc
tgtggaggatccctcattaacagtcagtgggtgctgactgctgctcactgctttcaaacc
accaacctgagaggactgactgtgaatctgggccgtcagagtctacagggatccaatccc
aatgcagtatctcgaactgtaacaaagatcatcaaacatccaaaatacaactctggtacc
tacgacaacgacatctgcctcctgcagctctcctcaccggtgaccttcaacaactacatt
tctcccgtctgcctggcagcttcaaacagcatcttctacagcggtgttaacagctgggtc
accggctggggaagtactagagaaggagcgtccgctccttcacccaacctgatggaggtg
gaggttcctgttgtgggaaacaggaagtgtaactgtaactatagagtgggatcaatcact
gacaacatgatctgtgccgggttaagtgcaggaggaaaggactcctgtcagggggattca
ggaggtccaatggtgagcaagcagagcggtcgctggattcaggcgggagtcgtcagtttt
ggggaaggttgtgccaggccgaatcttccaggagtctacgccagagtatcccagtaccag
acctggatcaggacccagatctcctccaaccagccgggcttcatgacgttcacgtccact
gggaccaacagtgacctcagtgtcacctgctga

DBGET integrated database retrieval system