KEGG   Maylandia zebra (zebra mbuna): 101487693Help
Entry
101487693         CDS       T02814                                 

Gene name
abat
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101487693 (abat)
   00650 Butanoate metabolism
    101487693 (abat)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101487693 (abat)
   00280 Valine, leucine and isoleucine degradation
    101487693 (abat)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101487693 (abat)
Enzymes [BR:mze01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     101487693 (abat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     101487693 (abat)
Amino acid related enzymes [BR:mze01007]
 Aminotransferase (transaminase)
  Class III
   101487693 (abat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MATSLISRQLAFSLQKNVWLSASGYRYVSKAAAKTQVEFDYDGPSMTTTVPGPRSQELMK
QLGQIQNTGAINFFCNYEESKGNYLVDVDGNRMLDIYTQISSIPIGYNHPALLKVMTNPN
NLSTFVNRPALGILPPENFPDKITESLLSVAPSGMTRVQTMSCGACSNENAYKAIFIWYR
NKERGPNTPTNEELNTSMINQAPGCPELSILSFMGGFHGRTLGCLATTHSKAIHKLDIPS
FDWPVAPFPRLQYPLDEFTRENAEEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQAEGG
DNHASPDFFRRLRNIARKHGCAFHVDEVQTGGGGTGKFWAHEHWGMDDPADVVSFSKKLL
SGGYYHKDELQADKPYRIFNTWMGDPSKNLFLSEVLNVIRRENLLEEVTRSGKALLNGLY
ELQAQYPSILSRARGQGTFCAIDACDDATRDRIMLKARDKGVLLGGCGDRTIRFRPALVF
KEYHVNLFLNIFNDVLAQHK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctccttgatcagtcgtcagctggctttctctctgcagaaaaacgtgtggctc
agtgcttcaggttacagatatgtcagcaaagcagcagcaaagacacaggtggagtttgac
tacgatggaccctccatgacaactacagtccctggtccacgatcacaagagctgatgaaa
caactgggacaaatacagaatactggtgccatcaactttttctgtaactatgaggagagc
aaagggaactacctagtggatgtggatgggaaccgcatgctggatatctacactcagatt
tcttccatcccaattggctacaaccaccctgctctcctcaaagtgatgaccaatccaaac
aatttgagtacatttgtgaatcggccagccttgggaatcctgccacctgagaactttcca
gacaaaatcaccgaaagtcttctctcagtggcacctagtggaatgactcgtgttcagaca
atgtcctgtggtgcttgctccaatgaaaatgcttacaaagctatttttatctggtatagg
aacaaagaacgaggcccaaacacaccaactaatgaagaactgaacacctccatgatcaac
caggcaccaggttgtccagaactcagtattttatctttcatggggggtttccatggaaga
acattaggttgtttggcaacaacacactccaaagcgatccacaaactggacattccatca
tttgattggcctgttgccccattccccagactacagtacccactggatgagtttaccaga
gagaacgctgaggaagaggctcgttgtttggaggaggtggaagatttgattgtgaagtgg
agacagaagggaaaacctgtagcgggaattgtaattgaaccgattcaggccgaaggcggc
gataaccacgcctcaccagacttcttccgaagactgcgcaatattgcacgcaagcatggc
tgtgcttttcatgtggatgaggtccagactggtggcggaggcacaggaaagttttgggcc
catgagcactggggtatggacgaccctgctgacgttgtctctttcagcaagaagcttctg
agtgggggttactaccacaaggatgaattacaggcagacaagccctaccgcatctttaac
acatggatgggtgacccgtcaaagaacttgttcctttctgaggttctcaatgtgattcgg
agagaaaatcttttggaggaagtgacccgctctggcaaagctttgctgaatggcctctat
gagctacaggctcagtaccccagcatactgagtcgagcccgaggacaggggacgttctgt
gccattgatgcctgtgatgatgccacacgtgacaggatcatgctcaaggccagagacaaa
ggcgtcctcctcgggggctgtggggatcgcacaatcagattccgcccagctctggttttc
aaggagtatcatgtgaacctcttcctcaatatttttaatgatgtgttggcgcagcacaaa
tag

DBGET integrated database retrieval system