KEGG   Maylandia zebra (zebra mbuna): 106674727Help
Entry
106674727         CDS       T02814                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     106674727
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106674727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 617 aa AA seqDB search
MAFYKVMCLAAGLMLLTQESESQLDVCGQPKLNTRIVGGQVAPVGSWPWQVSLQRFGSHF
CGGSLINSQWVLTAAHCFQTITATGLTVNLGRQSLQGSNPNAVSRTVTQIIKHPNYNSGT
NDNDVCLLRLSSPVTFNNYISPVCLAASDSIFYSGVNSWVTGWGNIGEGVSLPSPQNLME
VEVPVVGNRQCNCDYGVGSITDNMICAGLSAGGKDSCQGDSGGPMVSKQSGRWIQAGVVS
FGEGCARPNLPGVYARVSQYQTWIRTQISSNQPGFMTFTSTGTNSDLSVSCTGLPPVPTT
TPPTTTTPSTTTTTPATTVCGQAPRNSRNMGGPSVVAGSWPWMASLQKNGSHVCDGSLVA
LDSVLSNANCFSSSPVASEWTVVLGRLKLNGSNPFQVTLNVTNITLSNTTGTNIAILRLS
AQPTLTDYIQPICLDNGRTFAEGLACWAAGWSPGRGGAEEVMQQFQTSVVNCGNSSSSES
ICTDVFALQQGDSGGPLMCKQGGSWFQAVVLTAPSSSAGRRRSSVMTFTRLRTFDSFLSE
TVKSLLSPALNITSANSANPTNVSVTTTTSSTYTTTMVTTTTDSKSVFNSSEGRPAHSFI
FVFFHLLSFAFCLQLCL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggctttctacaaagtgatgtgtttggctgctgggctgatgctcctgacccaagagtct
gagtcacagctggatgtttgtggtcagccaaagctcaacaccaggattgtaggaggacag
gtggcccctgttggcagctggccctggcaggtcagtctgcaaagatttgggtcccacttc
tgtggaggatccctcattaacagtcagtgggtgctgactgctgctcactgctttcaaacc
attactgcaaccggtctgactgtgaatctgggccgtcagagtctacagggatctaacccc
aatgcagtgtctcgaacagtaacacagatcatcaaacatccaaactacaactctggtacc
aacgacaacgacgtctgcctgctgaggctctcctcaccggtgactttcaacaactacatt
tctcccgtctgcctggcagcttcagacagcatcttctacagcggtgttaacagctgggtc
accggctggggcaacattggagaaggagtgtcccttccttctccacaaaacctgatggag
gtggaggttcctgttgtgggaaacaggcagtgtaactgtgactatggagtgggatcaatc
actgacaacatgatctgtgccgggttaagtgcaggaggaaaggactcctgtcagggggat
tcaggaggtccaatggtgagcaagcagagcggtcgctggattcaggcgggagtcgtcagt
tttggggaaggttgtgccaggccgaatcttccaggagtctacgccagagtatcccagtac
cagacctggatcaggacccagatctcctccaaccagccgggcttcatgacgttcacgtcc
actgggaccaacagtgacctcagtgtctcctgcacaggactgccaccagtgccaaccacc
acccctccaaccaccaccacaccttcaaccaccactaccacacctgcaaccacggtctgt
ggacaagctccaaggaattctcgcaacatggggggaccctcagtggtggctggttcgtgg
ccgtggatggcgagcctacagaagaatggaagtcacgtgtgtgatgggtctctggtggcc
ttggactcagtgttgagcaacgccaactgcttctcaagctcccctgtagcgtccgagtgg
actgtcgtgttggggcgtctgaagctaaatggatccaacccctttcaggtgacgctgaat
gtgacaaatatcactctgagcaacacgaccgggaccaacatagccatcctccgtctatct
gcccagcccaccctgaccgactacatccagcccatctgcttggacaacgggagaaccttc
gccgagggcttggcgtgctgggcggccggttggagtcctggaagaggaggagctgaggaa
gttatgcagcagtttcagacctcggtggtaaactgtgggaactcatcatcgagtgagagc
atctgtacagacgtgtttgcactgcagcagggtgattctggcgggccgctgatgtgtaag
cagggcggctcttggttccaggcggtcgtgttaacagctccaagctcctctgccgggaga
agacgaagctcagtcatgaccttcaccagactgaggacctttgactccttcctgtctgag
acggtcaagtcactcttgtctccagccttgaatatcaccagtgccaactccgccaacccc
accaatgtctccgtcactaccactaccagcagtacctacaccaccacaatggttaccact
actactgactcgaaaagcgtgttcaacagcagcgagggtcgtcctgctcactccttcatc
tttgtcttcttccatctcctcagcttcgccttttgtctccaactctgcctttag

DBGET integrated database retrieval system