KEGG   Maylandia zebra (zebra mbuna): 106674864Help
Entry
106674864         CDS       T02814                                 

Definition
(RefSeq) trypsin-1
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106674864
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106674864
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106674864
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106674864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 242 aa AA seqDB search
MRSLVFVLLIGAAFALEDDKIVGGFECTPYSEPHQVSLNSGYHFCGGSLINQNWIVSAAH
CYKSRIQVRLGEHDISVNEGTEQFIDSSRVIRHPQYDSWNIDNDIMLIQLSQPASLNSYV
QPVALPRSCAPAGTMCTVSGWGNTMSSTADQDRLQCLNIPILSYSDCNNSYPGMITDSMF
CAGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAERDHPGVYTKVCIFNDWIQQTMA
SY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctctggtctttgttctgctcattggagctgcttttgccctggaagacgacaag
atcgtcggagggtttgagtgcacaccttactctgagccccatcaggtgtctctgaactct
ggctaccacttctgtggtggctccctgatcaatcagaactggattgtgtctgctgctcac
tgctacaaatctcgtatccaggtgcgtctgggagagcacgacatttcggtcaatgaggga
actgagcagttcatcgactcctcccgtgtcatccgccatccacagtatgattcctggaat
attgacaatgacatcatgctgatccagctgagccagcctgcctccctcaacagttatgtg
cagcctgtggctctgcccaggagctgtgctcctgctggcaccatgtgcacagtctctgga
tggggcaacaccatgagctctactgctgatcaggacaggctgcagtgcctgaacatcccc
atcctgtcctacagtgactgtaataactcctaccctggcatgatcactgactccatgttc
tgcgctggatacctggagggaggcaaggactcttgccagggtgactctggtggtcctgtt
gtgtgcaacggtgagctgcagggtattgtgtcctggggctatggatgtgctgagagggac
caccccggtgtctataccaaggtctgcatcttcaatgactggattcagcaaaccatggcc
agctattaa

DBGET integrated database retrieval system