KEGG   Neomicrococcus aestuarii: BHE16_11325Help
Entry
BHE16_11325       CDS       T04559                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nae  Neomicrococcus aestuarii
Pathway
nae00010  Glycolysis / Gluconeogenesis
nae00030  Pentose phosphate pathway
nae00051  Fructose and mannose metabolism
nae00052  Galactose metabolism
nae00680  Methane metabolism
nae01100  Metabolic pathways
nae01110  Biosynthesis of secondary metabolites
nae01120  Microbial metabolism in diverse environments
nae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHE16_11325
   00030 Pentose phosphate pathway
    BHE16_11325
   00051 Fructose and mannose metabolism
    BHE16_11325
   00052 Galactose metabolism
    BHE16_11325
  Energy metabolism
   00680 Methane metabolism
    BHE16_11325
Enzymes [BR:nae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BHE16_11325
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BHE16_11325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: APF41473
UniProt: A0A1L2ZPU8
LinkDB All DBs
Position
complement(2524462..2525490)
Genome map
AA seq 342 aa AA seqDB search
MRIGIMTSGGDCPGLNAVIRGAVLGGIKRHGDEFVGFKDGWKGVTEGEIIDLPRQSVRGI
SKQGGTILGTSRVNPYDGPLGGPEHISEVLKENSVDALMVIGGEGTLAGAKRLADAGLPI
VGVPKTIDNDLNGTDYTFGFDTAVQIGTEAIDRLRTTGESHHRVMVAEVMGRHVGWIALH
AGMAAGAHAILIPEVSVTADDIVQWVEEAFDRGRAPLVVVAEGFLLDGSDEAYSHLGLDE
AGRPRLGGVGEVVARLVQERTGLETRCTTLGYIQRGGVPSAYDRVLATRLGMAAAEAAHD
HAWGQMVALRGTELHRVPFSAALQSLKKVPQSRYDEAAILFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcatcatgacgagcggcggcgactgccccggacttaacgcagtgattcga
ggcgcagtcctcggcggaatcaagcgtcacggggatgaatttgtaggcttcaaggacggc
tggaagggcgtcactgaaggcgaaatcatcgacctcccacggcaatcagtgcgcggtatt
tccaagcagggcggcaccatccttggcacctcgcgcgtcaacccgtatgacggtccgttg
ggcggtcctgagcacatcagcgaggtgctcaaagagaacagcgtcgacgcgctcatggtc
attggcggcgaaggcaccctcgctggagcgaagcgtctggctgacgccggacttcccatt
gtgggcgtccccaaaactattgacaacgatctcaacggcacggactacaccttcggcttc
gacaccgcggtacagatcggcactgaagctattgaccgcttgcgcaccaccggcgaatcg
caccaccgcgtcatggtggccgaagtgatgggccgccacgtgggctggatcgctttgcac
gccggtatggccgccggagctcacgccatcctcatccccgaagtttctgtcaccgcagat
gacattgttcagtgggtggaagaggccttcgatcgtggacgcgcgccgctcgtagtggtg
gctgaaggcttcttgctcgacggttcggacgaggcctattcacaccttggcctcgatgag
gccggccgtcctcgcttgggcggtgtgggcgaagtcgtggctcgtctggtgcaagaacgc
acggggctcgagacccggtgcaccacgctggggtacatccagcgcggcggcgttcccagc
gcttacgaccgcgtcttggctactcgtctgggcatggccgctgctgaggcggcgcatgat
cacgcgtggggccaaatggtggcgctccgtggcaccgagttgcaccgcgtgcccttctct
gcggctttgcaaagcttgaaaaaggtgccgcaatcccggtacgacgaagcggctattctc
tttggctag

DBGET integrated database retrieval system