KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_01170Help
Entry
GQ61_01170        CDS       T04833                                 

Definition
(GenBank) hypothetical protein
Organism
naf  Candidatus Nucleicultrix amoebiphila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(247779..250565)
Genome map
AA seq 928 aa AA seqDB search
MKQGYQDQQSRLIRLTEEYLKEIGVHRPILEITLQSKLERDLGIDSLGRVELFHRIEEEF
KGHLPEKFLGEIECLEDILRILAEQKIIASQNRPSNKIKKIINRKEHHFDSDTLIGNLRK
YALDHPDRPHIYLLNEHGEELVITYGALYEDSQKVARGLISKGLKRGQTVAIMLPTSEDF
FPAFLGIQLAGGIPVPIYPPFRASKIEEYIKREAKILSNAEVQFLITFEQTKGISKILQS
FIPSLKGVFTVDSLKKKTSPYSNNHVLSSDPAMIQYTSGSTGDPKGVLLTHGNIIANLKS
AQEVISLKPSDVIVSWLPLYHDMGLIGSWLGSLYFGAPLVLMSPLTFLNRPDRWLWAIHV
YRGTLSAAPNFAYELCLKKIKDEDIAGLDLSCWRLALNGAESVQASTLDRFYKRFKSCGL
KQETLYPVYGLAESTVALTFPPLGHKPKIDIIDREIFEKQGKAMPSKKNSGVTRIVSCGK
PIPHHSVKIVDEKGRELPERKVGTLWFKGPSSMQEYYHNPVATKNISHNSWLDSGDLAYK
VDDEIYPVARKKDVIIKAGHNLYPQDIEAATELVSGVRKGCSCAFGVSNPEQGTERLVIV
AETNSKEKFERDRIVQNITARISDVLGFPPDEVLLTNPGTIPKTSSGKLQRSACKAAYLR
NELKRARIPLWIQIVKLSVFSFLLKLGKGAKESMKAIYTLYVFCVLLIIVGPFIISIACV
SNNLAPKLGKLWSKIILLLCGMFYRVRGHQYLTKCHPTIFVANHASYIDAIVLTAVLPAG
TIMIAKEELLHFAPLKWLLTKLGHVSIHRQEFKQSVRDYHKIEDILKFGHSVLIFAEGTF
TFAQGIRPFKMGAFQLSVDKKVALCPVSLKGTRQVLRDESYFLTPHMIEIYAHPPIIPTT
KGWRAALKLKNIVRQIIGESSGEPLLRH
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagggatatcaagatcaacagagtcgtctgattagattgactgaagaatatctc
aaggaaataggtgttcatcgaccaatcctagaaatcactctgcaatcaaaattagagcgg
gatttagggatcgatagccttgggcgtgtagaactttttcatagaattgaagaagagttt
aaaggacacttgcctgaaaaattcctaggcgaaattgaatgtttagaagatattttaagg
attcttgctgagcaaaaaattattgcttcacaaaacaggccttcaaacaaaattaaaaaa
attatcaatcgaaaagaacatcatttcgacagcgatacacttattggaaatttgaggaaa
tatgctcttgatcatcctgatcgtcctcatatttatctcttaaatgaacatggagaagaa
ctggttattacctatggtgcactttatgaagattctcaaaaggttgcgcgaggcttgatt
tctaaaggacttaagcggggacaaacagttgcgattatgttgccaacgtcggaggatttt
ttcccagcttttttgggtattcaactcgcaggcgggattcctgtgcccatctatccaccc
tttagagctagtaaaattgaagaatatattaaacgtgaagctaaaatcttatctaatgca
gaagttcagttccttattacatttgagcaaacaaaaggcattagcaaaattttacaatcc
tttattccttctttaaaaggtgtttttaccgttgactctctaaagaaaaagacaagccct
tattctaataatcatgtgttgtcatcagatccggctatgattcaatatacttctgggagt
acgggtgatccaaaaggagttttattaacccatggtaatatcattgctaatctgaaatcc
gctcaagaggttatatccctaaagccatctgatgttattgtcagttggcttccgctttat
catgatatgggcctcattggatcatggttgggaagtttatattttggggctcctttggtt
ttaatgtcgcctcttacatttctaaatcgtccggatcgttggttgtgggcaatccatgtt
tatcgaggaactctctctgctgcaccaaactttgcttatgaattgtgtttaaagaaaata
aaagatgaagatattgcgggacttgacctcagttgttggcgtttagcacttaatggcgct
gagagtgtccaagcgtcaacgttggataggttttacaagcgttttaaaagttgcggacta
aaacaagaaacactctatcctgtttacggtcttgctgagagtacagttgcacttacattc
ccgcctttaggtcataaacctaaaatcgatataatcgatcgggaaatttttgaaaagcaa
ggcaaggctatgccatcaaaaaagaatagcggtgtgacaagaatcgtttcttgtggaaaa
cctattcctcatcactctgtgaaaatcgtcgatgaaaaggggagagaattacctgaacga
aaagtggggactctttggttcaaagggccttccagcatgcaagaatattatcataatcct
gtagcaaccaaaaatattagccataattcttggttggattcaggggatctggcctataag
gttgatgacgaaatatacccagttgcacgaaaaaaagatgtcattattaaagctggacat
aacctttatccacaagacattgaagcagcgacagaacttgtttccggtgttcgtaaaggc
tgttcttgtgcttttggagtaagcaatcctgagcaaggaacagaacgtttagttattgtt
gcggaaacgaattcaaaagagaaatttgaacgagatagaattgttcaaaacataaccgca
cgtatttctgatgtgttaggttttccacccgatgaagtgctcctcacaaatccaggaacg
atacctaaaacatccagtggaaaattacaacgatcagcgtgtaaagcagcctatctgcgt
aatgagctgaaaagagcgcgaattcccttatggattcagattgttaaattatcagtcttt
agctttcttcttaaactcggtaaaggcgcaaaagagagtatgaaagcaatttatactctc
tatgttttttgcgttcttttaataatcgttggaccttttatcatcagtatcgcttgtgtc
tctaataacctagcacctaaactgggcaaactatggtctaaaattatcctgctcttatgc
gggatgttttatagagtaagaggtcatcaatatttaacaaagtgtcatcccacaattttt
gtggccaatcatgccagttacattgacgccattgttttaaccgctgttctacctgctggg
actattatgattgccaaggaagaattgctgcacttcgcacctttaaaatggcttttaaca
aagttagggcatgtaagtattcatcgtcaggaatttaagcagagtgtacgcgattatcac
aagattgaagacattttaaagtttggtcattcagtacttatctttgcggaagggacgttt
acttttgcccaaggaattcgaccttttaaaatgggcgcttttcaattatcggttgataag
aaagttgctttatgtcctgtttccctcaaaggaacgcgtcaggtattaagagacgaaagt
tattttctaacccctcatatgattgaaatttatgcgcatcctcccattattcctacaaca
aagggttggagagcagcgcttaaactgaagaatatcgtgagacagattattggtgaatca
tcaggcgaaccgctcttaagacattaa

DBGET integrated database retrieval system