KEGG   Necator americanus: NECAME_04374Help
Entry
NECAME_04374      CDS       T04867                                 

Definition
(RefSeq) superoxide dismutase [Mn]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nai  Necator americanus
Pathway
FoxO signaling pathway
Peroxisome
Longevity regulating pathway - worm
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nai00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    NECAME_04374
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    NECAME_04374
 Organismal Systems
  Aging
   04212 Longevity regulating pathway - worm
    NECAME_04374
   04213 Longevity regulating pathway - multiple species
    NECAME_04374
Enzymes [BR:nai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NECAME_04374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 216 aa AA seqDB search
MLSLPIRTLCRSARLTSVRAKHSLPDLPYDYNALEPVICTEIMQLHHQKHHATYVNNLNA
CEEKIHEALSKGNIKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELMTAIKRDF
GSLEKMQESLSTATIAVQGSGWGWLGYCPKQKKLKVATCANQDPLEPTTGLIPLFGIDVW
EHAYYLQYKNVRPDYVKAIWKIANWKNISERFAKAK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttatccttgccaattcgaaccctttgccgaagcgctagacttacatcagtaagagcc
aagcacagtcttccggatcttccatatgactacaatgcattggagcctgtcatctgtacc
gagattatgcaactacatcaccagaaacatcatgcgacatatgttaacaatctaaacgcc
tgcgaggagaagattcatgaggctctttcaaaaggcaatatcaaagaagcgattgctttg
caaccagcactgaaatttaacggcggtggtcacatcaaccactcaattttctggacaaat
ttagccaaggatggaggagaaccgagtgctgaactaatgactgccataaagagagatttt
ggatcattggagaagatgcaagaatctttgtcgaccgctacaatagccgtccaaggatct
ggttggggatggttgggttattgtccgaaacagaagaaactgaaggtggcaacatgtgct
aatcaagatcctctcgagcctacaaccgggctaattccattgtttggaatagacgtctgg
gagcatgcctactatcttcaatacaaaaacgttcgacctgactatgtgaaagcgatttgg
aagattgccaactggaagaatattagcgaaagatttgcgaaagcaaagtaa

DBGET integrated database retrieval system