KEGG   Necator americanus: NECAME_05910Help
Entry
NECAME_05910      CDS       T04867                                 

Definition
(RefSeq) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
nai  Necator americanus
Brite
Translation factors [BR:nai03012]
 Eukaryotic Type
  Elongation factors
   NECAME_05910
 Prokaryotic Type
   NECAME_05910
Mitochondrial biogenesis [BR:nai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NECAME_05910
Exosome [BR:nai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NECAME_05910
  Exosomal proteins of breast cancer cells
   NECAME_05910
  Exosomal proteins of colorectal cancer cells
   NECAME_05910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 25345942
NCBI-ProteinID: XP_013308833
UniProt: W2TZV0
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
TVFGSSLGERVVSKVLRSQQVRCLAVPGGKEVFKRNKPHLNVGTIGHVDHGKTTLTSAIT
KVLATSKGAKFRKYEDIDNAPEEKARGITINAFHLEYETAKRHYAHIDCPGHADYIKNMI
TGAAQMEGAILVVAATDGAMPQTREHLLLAHQVGIPRENVAVYLNKVDEVPDQETRELVE
MEIRELLNEFEYPGDTAPVIFGSALCALEGKKPEIGEESIKQLLNVLDEKFVIPERNVNT
EAMFAAEHVYSIQGKLFFTNLTYMIILVGRGTVITGKLERGTLKRGDKIEIIGCDRENTK
SVISGLESFRKTVEQAEPGDQLGILLRGLGPKDVRRGCVLLPQGHKHKATDKVKAQLYIL
KPSEGGSKVPLANYFSEHVFSLTWDTSALLKINGKDFVMPGEAAEVELRLSQKMFIEPQQ
RFTIRKGTTTVGTGVFTEVLPPQTEEEKNPKNKKKLMKAEMERLGFNPYGELMEKRLKPD
YSNSPKDNPAAKAFEGAEA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
acggttttcggcagctcactgggtgaacgggtagtgtcaaaagtgctgaggtcacaacag
gttcgatgtttggcagtaccgggtgggaaagaagttttcaagcgtaacaaacctcatctg
aacgttggtactatcggtcacgttgatcatggaaagaccacattgacatcggcaattacc
aaagtcttagccacgtcgaaaggtgccaagtttagaaaatatgaggatattgacaacgca
cctgaagagaaggcaagaggtatcactataaacgcctttcatcttgaatatgaaaccgcg
aagcgtcactatgcacatattgattgtcctggacatgctgattacatcaagaacatgatc
accggagcagcacaaatggaaggagcgatccttgtcgttgcggccaccgatggcgcaatg
ccacagactcgtgagcatctccttctcgcccatcaagttggaattcctcgtgaaaatgtc
gcagtgtatttgaacaaggttgatgaagttccggaccaagagacccgtgagttagttgaa
atggaaatccgtgaattactcaatgaattcgagtatcctggagacaccgcaccagttatt
ttcggctctgctctgtgcgcacttgaagggaaaaaaccagaaattggtgaagagtctatc
aaacaactcttgaatgtcctcgatgaaaagttcgttattccggaaagaaatgtaaacacc
gaagccatgtttgctgctgaacacgtgtattcaatccaaggcaagttgttttttactaat
ttgacgtacatgattatacttgtaggccgaggaactgttattactggaaagcttgagcgt
ggaacgttgaaacgtggtgacaagatcgaaatcattggttgtgatagggaaaacacgaaa
tcagttatttctgggctcgaatcgttccgtaagacagtcgagcaggcggaacccggagat
cagttgggaatcttgcttaggggtctcggaccgaaagacgtccgaagaggttgcgttcta
ttgccccagggacacaaacacaaggcaaccgataaagttaaggcacagctctacattctc
aagccatctgagggtggatctaaggtacctttagccaattacttcagtgagcacgtgttc
tcactgacatgggatacatctgctttgcttaaaattaatggaaaagactttgtcatgcct
ggagaagcggccgaagtagagttgcgactaagtcagaaaatgttcattgaacctcaacaa
cgattcacaatccgtaaaggaactacaacagttggaactggggtcttcacagaagtatta
ccaccacaaactgaagaagagaagaaccctaagaacaagaaaaagctgatgaaggcagag
atggagcgacttggcttcaatccttacggagaattgatggagaagcgattgaagccggac
tactcgaattcgcccaaggataatccagcagcgaaggcattcgagggagctgaagcataa

DBGET integrated database retrieval system