KEGG   Nitrospirillum amazonense: Y958_10030Help
Entry
Y958_10030        CDS       T04935                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nao  Nitrospirillum amazonense
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nao00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Y958_10030
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Y958_10030
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Y958_10030
Enzymes [BR:nao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Y958_10030
Peptidoglycan biosynthesis and degradation proteins [BR:nao01011]
 Precursor biosynthesis
  Amino acid ligase
   Y958_10030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:2176350..2177282
Genome map
AA seq 310 aa AA seqDB search
MSGHQPKHVTVLMGGWSAEREVSLVSGASIVTALESKGYVVRAVDVQRDLAGLLAALTPK
PDVIFNALHGRGGEDGMIQGVLEYLGVPYTHSGVMASAVAMDKAMTKRVLGTVGMPIAQD
VIATREAVLAGHVMEPPYVIKPVDEGSSVGVRIVRAGHNGPAIEAEHWVYGDTVMVEKFI
PGRELTVGVVGDRALTVTEIVASTEFFDYTAKYTEGHAVHVCPAQIPAEVAEEAKRLALL
AHQTLGCSGVSRSDFRWDDGKPGVTGLCFLETNTQPGFTPLSLLPEQAAYVGLSYADLCG
WIVEHAACHG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtcaccagcctaagcatgtcaccgtcctgatgggcgggtggtctgccgagcgc
gaggtgtcgcttgtcagcggcgcgtccatcgtcaccgccttggaatccaagggttatgtc
gtgcgcgccgtggatgtgcagcgcgacctggccggcctgctggcggcgctgacgcccaag
cccgacgtgattttcaacgccctgcacggccggggcggcgaggacggcatgatccagggc
gtgctggaatatctgggtgtgccttacacccattccggcgtcatggcctccgccgtcgcc
atggacaaggccatgaccaagcgcgtgctgggcacggtgggcatgcccatcgcccaggac
gtcatcgccacccgcgaggcagtgctggccggccatgtcatggaaccgccctacgtcatc
aagccggtggacgagggctccagcgtcggcgtgcgcatcgtgcgcgccggccacaacggc
cccgccatcgaggcagagcactgggtctatggcgacaccgtcatggtggagaagttcatc
cccggccgcgagctgaccgtgggcgtggtaggcgatcgcgccttgaccgtgaccgagatc
gtggccagcaccgagttcttcgactacacggccaaatacaccgagggccacgccgtccac
gtctgcccggcccagatcccggcagaggtggcggaggaagccaagcgcctggccctgctg
gcccaccagaccctgggctgcagcggcgtcagccgcagtgacttccgctgggacgacggc
aagcccggcgtcaccggcctctgcttcctggagaccaacacccagccgggcttcacgccc
ctgtcgctgctgccggaacaggcggcctacgttggcctcagctacgccgacctgtgcggc
tggattgtggagcacgcggcatgccacgggtga

DBGET integrated database retrieval system