KEGG   Natrinema sp. J7-2: NJ7G_0819Help
Entry
NJ7G_0819         CDS       T02184                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00630  Glyoxylate and dicarboxylate metabolism
nat01100  Metabolic pathways
nat01120  Microbial metabolism in diverse environments
nat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NJ7G_0819
Enzymes [BR:nat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NJ7G_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFO56068
UniProt: I7CQ19
LinkDB All DBs
Position
complement(742845..744110)
Genome map
AA seq 421 aa AA seqDB search
MSDGIMTGIEYDDFLDLGYEPAGTELVCEFTIEPAAGMSMEAAASRVASESSNGTWAALH
VDEDELTDLGAVACGIDGRTVTVAYPTALFEAGSMPQLLSCIAGNILGMKAVDSIRLEDC
DWPESITSGFPGPQFGPSVAREKLDAGERPVLATVPKPKVGLSTDAHARIGEEAWRGGVD
LLKDDENLTDQAFNPFADRLAESLAARDRAQEETGERKDYLVNVTAETTEMLERVDLVAE
HGGGFVMVDVITCGWAAVQSVRERCEDHGLAIHAHRAMHAAFDRLDHHGVSMRVIAQIAR
LCGVDHIHTGTAGLGKLANEDTPGINEWLTSDCHGLRPVLPVASGGLHPGVVDQLIDALG
TDIIVQAGGGIHGHPDGTHAGAKALRQSVEASMAGTDLETYADDHAELATALEKWGAETP
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggtatcatgacagggatcgagtacgacgactttctggacctcggatacgag
cccgctgggacggaactggtctgtgaattcacgatcgaaccggccgcggggatgtcgatg
gaggcggcggcgagtcgcgtcgcctctgagtcatcgaacgggacctgggccgccttacac
gtcgacgaggacgaactcacggatctcggtgcggtcgcctgtggcattgacggacggacg
gttacagtcgcgtacccgactgcgctgttcgaggccggcagtatgccccaactcctctcg
tgtatcgccggcaacatcctggggatgaaagccgtcgattcgatccgactcgaggactgc
gactggccggaatcgatcacgagcgggtttccgggcccgcagttcgggccgagcgtcgcg
cgcgagaaactggacgcgggtgagcggccggtgttggcgacggtgccgaaacccaaggtg
ggcctctcgaccgacgcccatgcccggatcggcgaggaggcctggcgcggcggtgtcgac
ctgctgaaagacgacgagaacctcaccgatcaggcgtttaaccccttcgcggaccgactc
gccgagagcctcgccgcccgcgaccgcgcccaggaggagaccggcgagcgcaaggactac
ctcgtgaacgtgaccgccgagaccaccgagatgctcgagcgggtcgacctcgtcgccgaa
cacggcggcgggttcgtcatggtcgacgtgatcacctgtggctgggcggccgtccagtcg
gttcgggagcgttgcgaggaccacgggctggcgatccacgcccaccgcgcgatgcacgcc
gccttcgaccgactggaccaccatggggtatcgatgcgcgtcatcgcccagatcgcccgc
ctctgtggcgtcgaccacatccacaccgggaccgcggggctgggaaagctcgcgaacgag
gacacgccggggatcaacgagtggctcacgagcgactgtcacggcctcaggcccgtcctc
ccggtcgcctccggcggactgcatcccggcgtggtcgatcaactcatcgacgcgctggga
accgacatcatcgtgcaggccggcggcggcatccacggccacccggacggcacgcacgcg
ggtgcgaaagcgctccgacagtccgtcgaggcctcgatggcgggcacggacctcgagacc
tacgccgacgaccacgcggaactggcgacggccctcgagaagtggggcgcggagacgccg
cggtaa

DBGET integrated database retrieval system