KEGG   Nocardia brasiliensis: O3I_014425Help
Entry
O3I_014425        CDS       T02270                                 

Definition
(GenBank) non-ribosomal peptide synthase
Organism
nbr  Nocardia brasiliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3223638..3227936)
Genome map
AA seq 1432 aa AA seqDB search
MALRRAATLPQLLADRAAETPDRPGFTYLSDTGDTRTLSYGEVYAAAADIATTVREVGAP
GDRVLVVAVFGPHFLTSFFGCMLAGRIPVPVANHQPGAAFSDLAALANLAADCAATAIMA
PRAALDRIRAAGAQYPQLARIAWLADDEPSGTATEFGAVAPESLAFLQYTSGSTRAPRGV
MVTHTNLMHNLGVIERTFGHTTDSKGVIWLPAQHDMGLIGGLLQPLYAGFPVVLLSPETF
VRDPLTWLRAISEHGGTTSGGPNVCYDYSVRRVAAAEVTGLDLSRWEVAFVAAEPINPRA
LQRFADHFAPAGFRPQSLTPGYGLAESTLFVSVTPRGAGVRSTVLAGREVVSCGELSGGD
AAIVSLAGDQRAEPGEIGEIWLSGPSVAAGYWSSDAETAAAFGARLPGDPATYLRTGDLG
FLRDGELYVTGRVKELIIIRGRNIAPQDIEWTIETRHPALRRGRCAAVGVEVDGTESLAV
LLEVDADKLAGTLADLETSIRQAISQSYGLDLHSAVFLSPGQLPRTTSGKVQRLKAKEEF
LAEATRPTPTAPTEGVPARLARWLAQRTGVPAAELDTEKPLTTVGLDSVKAGEFGVFVER
EFGYTVSAERLFEGLTTAQLAADIVARRPTGAIGAVERRAHPARSATAPVEFSLFFFASD
AQRDNANRYGLFLDSAAFADQHDFRAIWLPERHFHRFGGLFPNPAVLGGVLARTTKRIRI
RAGSVVLPLHDPVRVAEDWSMIDNLSGGRVDIAFATGWNPDDFVLAPGDYAEREQVMLSG
ADKVRRLWRGESLTLPNGKGEPVAIRTFPPPVQSELPMWITCSGGVGRFEQAGALGANVL
TALLFQDIAELRGKIEAYRSARAAHGHDPRTGHVTLMLHTFLDPDADRVRAVVERPFKEY
LRDSVDLWRRGAEPLNNLDAAEQDRVLDYAFARYFHTSALLGTPEHAATMVAELAAAGVD
EIACLVDFGVEPAVVLDGLRHLATLRDRFGVLPDQYAARNAVRDRHPGTTAAPPADELAD
AELSASVRGRHALAHRNSGGVLAKARDFDLARRLQEADLLPFYPDLSDSDGATCRYQGRQ
LIMLGSNNYLGLTADRRVREATAAAALEDGPSVTGSRLMNGSTPAHGALERRLARFLGRP
DALLFTTGYQANLGLLSAFMGAGTVLLVDEQCHASIYDGAAIGGCRLIQFRHNDSADLDR
RLRTDAHGLPALVMVDGVYSMSGDIARLAEIRAVCDRHQVPLAVDDAHGLGMIGATGRGV
EEELGLAGCADILTGTFSKSLASVGGWLAGPRDLLDWVRYYGRAQLFSASIPPPAVAAAA
AALDILAAEPERVKKVRALSARWRTGLAELGFDTGTSTTTIVPVLIGDELLCLRFAKRLL
DEGVYANCVLAPAVAADRAMMRTTVTAVHEPDQLDRALTVFEKVGRELRVLA
NT seq 4299 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctacgccgtgcggcgacacttccgcagctactggccgatcgagccgccgagaca
ccggatcggcccggcttcacgtacctgtccgacaccggcgatacgcgcacactgagctac
ggcgaggtgtacgccgcggcagcggatatcgccacgacggtgcgtgaggtcggcgcaccg
ggcgatcgggtgctcgtcgtcgcggtgttcggcccgcacttcctgacctcgttcttcggc
tgcatgctggccgggcgaatcccggtgccggtcgcgaatcatcaacccggagcggcattc
tcggacctcgcagcgctggcgaacctggccgcggattgcgcggcgacggcgatcatggca
ccccgcgccgcactcgaccggatccgggcggcgggtgcgcagtacccgcaactggcgcgg
atcgcatggctcgccgacgacgaaccatccggcaccgcaaccgaattcggagccgtagca
ccggaaagccttgcgttccttcagtacacatcgggctcgacccgcgcaccgcgaggcgtc
atggtcacccacaccaacctcatgcacaatctgggggtcatcgagcgaaccttcgggcac
accaccgacagcaagggcgtcatctggctgcccgcgcagcacgacatggggctgatcggc
ggtctcctgcaaccgctctacgcgggctttccggtggtgctgctgtccccggagaccttc
gtccgcgatccgctcacctggttgcgcgccatctccgaacacggcggcaccaccagcggc
gggccgaacgtctgctacgactacagcgtgcggcgggtcgccgccgccgaggtcacaggc
ctggacctcagccgctgggaggtcgcgttcgtcgccgcggagccgatcaatccgcgtgcg
ctgcaacgcttcgccgaccatttcgcaccggcggggttccggccgcagagtctgacgccc
ggctacgggctggcggagtcgaccctgttcgtcagcgtgacgccgcgcggcgcgggcgtg
cgttccaccgtgctggccggacgcgaggtggtcagctgtggcgagctgtccggcggcgac
gccgccatcgtgagcctggcgggcgaccagcgggccgaaccgggcgagatcggcgagatc
tggttgagcggaccgagtgtcgccgccggctactggagcagcgacgccgagaccgcggcg
gccttcggagcccgtttgcccggcgacccggcgacctatctgcgcaccggcgacctcggg
ttcctgcgcgacggcgagctctacgtcaccgggcgggtgaaggagctgatcatcatccgc
ggacgcaacatcgcgccgcaggacatcgaatggaccatcgagacaaggcatcccgcgctg
cgccgagggcggtgtgcggccgtcggcgtcgaagtcgacggaacggagtcgctcgcggta
ctgctggaagtggacgccgacaagctcgccggcaccctggcagatctggaaacctctatc
cggcaagccatctcgcagtcctacggtctcgacctgcactcggcggtcttcctctcccca
gggcagctaccgcgtacgaccagtggcaaagtacagcggctgaaggccaaggaggagttc
ctcgccgaggccacgcggcccaccccgacggcacccaccgagggcgtgccggcccggctc
gcgcgctggctggcccagcgcacgggcgtcccagccgccgagttggacaccgagaagccg
ttgaccacagtgggtctggattcggtgaaagccggcgagttcggcgtcttcgtggagcgc
gagttcggctacaccgtctcggccgagcgactgttcgaggggctgacgacggcgcagctg
gccgccgacatcgtggcgcgaaggccgaccggcgccatcggcgcagtggaacgccgcgcc
cacccggctcgatccgccaccgccccggtcgaattcagcctgttcttcttcgccagcgac
gcgcagcgggacaacgcgaaccgctacggcttgttcctcgacagcgctgccttcgccgac
caacacgatttccgcgctatctggttgccggagcggcacttccaccgcttcggcgggctg
ttcccgaatccggcggtgctcggtggcgtgctggccaggacgaccaaacggatccggatc
cgcgcgggcagcgtggtgctgccgctgcacgatccggtacgcgtcgccgaagactggtcc
atgatcgacaatctctccggcggccgggtcgatatcgcgttcgccaccggctggaatccg
gacgacttcgtgctcgcccccggcgattacgccgagcgcgagcaggtgatgctgtccggc
gcggacaaggtccgccgattgtggcgcggcgagtcgctcaccctgccgaacgggaaggga
gaaccggtagcgatccggaccttcccgccaccggtccagtccgagctgccgatgtggatc
acgtgcagcggcggcgtcggccgcttcgagcaggcgggcgccttgggcgcgaatgtcctg
accgcgctgctgttccaggacatcgccgaactgcgcggcaagatcgaggcctatcgcagc
gctcgtgcggcccacggccacgacccgcgcaccggccacgtcacgctgatgctgcacacc
ttcctcgaccccgacgcggaccgggtccgggcggtggtcgagcggccgttcaaggagtat
ctgcgtgattcggtcgatctgtggcgacgcggtgcggagccgctgaacaatctcgatgcg
gccgaacaggatcgggtgctggactacgcgttcgcccgctacttccacaccagcgcactg
ctcggcactccggaacacgccgcgacgatggtcgcggagctggcggccgccggggtggac
gagatcgcctgcctggtcgacttcggcgtcgagcccgcggtggtcctcgacgggttgcgc
cacctcgcgacgctgcgagaccgattcggcgtgttgccggatcagtacgccgcgcggaat
gcggtgcgcgacaggcaccccggcacaaccgccgccccgcccgccgacgagctcgccgac
gcggagctcagcgcgtccgtgcgtggtcgtcatgcgctggcccaccgcaacagcggcgga
gtgctggccaaggcccgtgatttcgatctggcgcgccggttgcaggaggcggacctgctg
ccgttctaccccgacctgagcgactcggatggcgccacctgccgatatcagggtcggcag
ctgatcatgttgggttccaacaactatctgggcttgaccgcggaccggcgggtccgtgag
gccaccgccgcggcggctctcgaggacgggccgagcgtcaccggctcccggctgatgaac
ggctccacccccgcgcacggcgcgctcgaacgccgcctcgcgcgtttcctcggccggccg
gacgcgctcctgttcaccaccggatatcaggcgaatctcggcttgctgtccgcgttcatg
ggtgcgggcacagtgctactcgtcgacgagcagtgccacgcgtccatctacgacggcgca
gctatcggtgggtgcaggctgatccagttccggcacaacgacagtgccgacctcgaccgg
cgcctgcgcaccgacgcacacgggctgcccgcgctggtgatggtggacggcgtgtattcg
atgtccggagatatcgcgcgcctggccgagattcgcgcggtgtgcgaccgccaccaggtc
ccactcgcggtggacgacgcacacggcctcggcatgatcggcgcgaccggacgcggcgtc
gaggaggaactcgggctggcgggctgcgccgatatcctcaccggaacgttctccaagagt
ctcgcgtcggtgggcggctggctggccgggccgcgcgatctgctcgactgggtgcggtat
tacggtcgcgcccaactgttctcggcgtctattccgccacccgccgtcgccgcggccgcg
gccgcgctcgacatcttggcggccgaacccgagcgtgtgaagaaggtgcgtgcgctgtcg
gcacgatggcggacgggcttggcggagttgggcttcgacaccggtacctcgaccaccacc
atcgtgccggtactgatcggtgacgagttgctgtgcctgcgtttcgcgaaacgcctactg
gacgaaggtgtctacgccaactgcgtgctggcgcccgcggtggcggccgaccgggcgatg
atgcgcaccacggttaccgcggtgcacgaacccgaccagctcgaccgcgcgctgacggtg
ttcgagaaggtcgggcgcgagttgcgcgtactcgcctga

DBGET integrated database retrieval system