KEGG   Nocardia brasiliensis: O3I_022660Help
Entry
O3I_022660        CDS       T02270                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
nbr  Nocardia brasiliensis
Brite
Enzymes [BR:nbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     O3I_022660
Lipid biosynthesis proteins [BR:nbr01004]
 Acyl-CoA synthetase
  Unknown
   O3I_022660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5155878..5157578
Genome map
AA seq 566 aa AA seqDB search
MRENWVTDVVAGYENDHAPAHEYLGENGEWTVVSRHELLHGVRAAATGWRAAGARPGDRV
AMEATDPHLFVPAFLGALWAGVVPVPVPPPPPQGRRAAWHDHVAAMAAAAQTRAIALRAG
TAAPAGSERTIVLDTVVAAAPDTTDPCHPEPDATAYVQFSSGSTGTPRAIPARVAAVRAN
GMAIMRDGLRGDPAVDRGLSWLPLHHDMGLVGFVLAPLLIGVPVSFVPTRAFVRHPGLWL
RAMSERRATISFAPNFAYALSARRTSPEEIAALKLDHVRVLGCGAEPINNAVLQRFLSTF
APAGLEPEALTPCYGLAEATLAVALATPDRPYRVDRIRASELSGGRAVPLDPAAADGIPA
QTENNTATGVSEETATIVSCGPPLPGHEIVVRDDAGETVAERSIGEIWVRGPSIARTYLG
AFSATHNTFRPDGWLRTGDLGYLADGELFVTGRVKDLLILNGRNIDPQRVEWVAETVAGV
RAGGVVACTRPGSGSEELVVVAECRTADTTEIPAALREAVAATLGIPVHDVVTVAPGTVP
RTTSGKPRRQETRRRYLEGALHVQQS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgaaaactgggtcaccgatgtcgtggccggttacgagaacgaccacgcgcccgcc
catgaatacctcggcgagaacggcgaatggaccgtcgtcagccggcacgagctactgcac
ggggtgcgcgctgccgccacgggatggcgtgcggccggtgcgcgacccggtgaccgggtc
gcgatggaggccaccgacccgcacctgttcgtcccggccttcctcggcgccctgtgggcc
ggtgtcgtgccggttccggtgccgccaccgccgccgcagggacgtcgcgccgcctggcac
gatcacgtggcagcgatggcggcggcagcgcagacccgggcgatcgcactgcgcgccggc
accgccgcacccgcgggcagcgagcggacgatcgtcctggataccgtcgtggccgctgca
ccggacacgacggacccctgccatcccgaacccgacgcgaccgcgtatgtgcagttcagc
agcggcagcaccggaactccgcgcgcgatcccggcccgggtggccgcggtgcgcgccaac
gggatggccatcatgcgcgacggcctgcgcggcgatccggccgtggaccgcgggctgtcc
tggctgccactgcaccatgacatggggctggtcggattcgtcctggcgcccttgctgatc
ggcgttcccgtctccttcgtgccgacccgcgccttcgtccgccaccccggcctgtggttg
cgcgccatgtccgagcggcgcgcgacgatcagtttcgcccccaatttcgcctacgcgctc
agcgcccgccggacctcgcccgaggagatcgccgcgctgaagctcgatcacgtgcgcgtg
ctcgggtgcggcgctgaaccaatcaacaatgctgtgctgcaacgctttctgagcaccttc
gcgcccgcgggactcgaacccgaagcgctgacaccgtgttatggactcgccgaggcaacc
ctcgcggtcgcgctcgccacgccggatcgcccctaccgcgtggaccgtatccgcgccagc
gaattgtccggcggacgcgccgtaccactcgatccggcggcagccgacgggatcccagcg
cagaccgaaaataacaccgcgactggcgtttccgaggaaacggcgacgatcgtcagctgt
ggaccacctttgcccggtcatgagatcgtcgtgcgcgacgacgccggcgaaacggtcgcc
gagcggagcatcggcgagatctgggtgcgcgggccttcgatcgcacgcacctatctgggc
gcgttctccgcgacgcacaacacgtttcggccggacggctggctgcggaccggtgacctc
ggctacctcgccgacggggaactgttcgtgaccggcagggtcaaggatctgctgatcctc
aacggccgcaacatcgatccgcaacgggtggaatgggtcgccgagaccgtggccggtgtg
cgggcgggcggggtcgtcgcctgcacccggccgggatcgggctccgaggaactggtcgtg
gtcgcggaatgccggaccgcggacacgacggaaataccagcggccctgcgggaagcggtc
gcggccaccctcggcatcccggtgcacgacgtggtgaccgtggcccccggcaccgtgccc
aggacgacctctggaaagccacgacggcaagagacccgccgccgttatctggaaggggcg
ctgcatgtccagcaaagctga

DBGET integrated database retrieval system