KEGG   Nocardioides sp. JS614: Noca_1237Help
Entry
Noca_1237         CDS       T00443                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nca00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Noca_1237
Enzymes [BR:nca01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Noca_1237
DNA repair and recombination proteins [BR:nca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Noca_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1313226..1314140
Genome map
AA seq 304 aa AA seqDB search
MAQPEKEEVRVQVDGRTLTISNLYKVLYPRTGTTKGEVLNYYAQVAPTLLPHLAGRCVTR
IRWPHGVHEGSFFEKNAPAGTPSWVRTAEVPTTGSRAQSSSDTLVFPIIEDLATLTWLVN
LAALELHVHQWTVDRSGRPRGADRVVVDLDPGEPAGLHECCRVALMVRDRLAERGLAAKP
VTSGSKGLHLYADLPERVPSEDSSALAKAVAEELQGEHPALVTATMTKARRAGKVFLDWS
QNAGSKTTVSPYSLRGRELPTVATPLAWAEVEAGAQDPMALRQFRFDEVLERVQEHGDLF
AGPR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcccgagaaggaggaggtccgggtccaggtggacggccggaccctcaccatc
agcaacctgtacaaggtgctctacccccgcaccggcaccacgaagggggaggtcctcaac
tactacgcccaggtcgcgccgacgctgctgccgcacctcgcggggcgctgcgtcacccgg
atccgatggccgcacggcgtgcacgagggcagcttcttcgagaagaacgccccagccggc
accccgtcgtgggtgcggaccgccgaggtccccacgaccggcagccgcgcccagtccagc
tccgataccttggtcttcccgatcatcgaggacctggcgaccctcacctggctggtcaac
ctcgcggccctcgagctgcacgtgcaccagtggaccgtcgaccgcagcggccgcccgcgg
ggcgcggaccgggtcgtcgtcgacctcgacccgggggagccggccggcctgcacgagtgc
tgccgggtcgccctgatggtgcgcgaccggctcgccgagcgcgggctggcggccaagccg
gtcaccagcggcagcaagggcctgcacctgtacgccgacctgccggagcgggtgccgtcc
gaggactcctcggcgctggccaaggcggtcgccgaggagctccagggggagcacccggcg
ctggtgaccgcgaccatgaccaaggcccggcgcgcggggaaggtgttcctggactggtcg
cagaacgccggctcgaagaccaccgtctcgccgtactccctgcgggggcgagagctgccc
acggtcgcgacgccgctcgcctgggccgaggtcgaggcgggcgcccaggacccgatggcg
ctgcgccagttccgcttcgacgaggtgctcgagcgcgtccaggagcacggcgacctgttc
gccggcccccgctga

DBGET integrated database retrieval system