KEGG   Notothenia coriiceps (black rockcod): 104946727Help
Entry
104946727         CDS       T04920                                 

Gene name
hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    104946727 (hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    104946727 (hdac1)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104946727 (hdac1)
Chromosome [BR:ncc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     104946727 (hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     104946727 (hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    104946727 (hdac1)
  Chromatin remodeling factors
   NuRD complex
    104946727 (hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MALSSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
SGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLG
GGGYTIRNVARCWTYETAVALDTSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEEDDPNKRISIRAHDKRIACEEE
FSDSEDEGEGGRRNAASFKKAKRAKTEGEKEGEEKEKKTEEETKEVKEEEKAPEEEKMDT
SKPKEESKTP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttagttctcaaggaacaaagaaaaaagtttgctactactatgacggtgatgtt
ggaaactactactacggacaggggcaccccatgaagccccaccgaatccgcatgactcac
aacttgttgctcaactatggactctacagaaagatggagatctatcgtccacacaaagcc
agcggagaagagatgaccaagtatcacagtgatgattacatcaagttcctgcgttcaatt
cgaccggacaacatgtcagaatacagcaaacaaatgcagagatttaatgtgggagaggac
tgtccagtttttgatgggttattcgagttctgccagctatcaggagggggctctgttgct
ggtgcggtgaagttgaacaaacagcagacggacattgccatcaactgggctggaggcctg
catcacgccaagaagtctgaggcctccgggttttgctacgtcaacgacattgttctggca
attcttgagttactgaaataccaccagagagttctgtacatcgacattgacatccatcat
ggagacggtgtggaggaggctttctacaccacagaccgtgtcatgacggtgtccttccac
aagtacggagagtacttccctggcacaggcgacctgagggacatcggtgctggtaagggt
aaatattacgctgtgaattacccgctgagggatgggattgacgatgagtcttatgaagcc
atattcaaacctatcatggccaaggtgatggagatgtaccaacccagcgcagtggttctg
cagtgtggagctgattctctgtcaggagacaggctcggttgctttaacctcaccattaaa
ggccatgcaaagtgtgtggagtacatgaagagcttcaacctgccactgctcatgctggga
ggaggaggctacaccatccgtaacgtggcacgctgctggacttatgagacggctgtggcc
ctggatacctccatccccaacgagctcccatacaacgactactttgagtactttggacca
gacttcaagctgcacatcagcccctccaacatgactaaccagaacaccaatgactacctg
gagaagatcaagcagcgcttgtttgagaacttgcgcatgctgccccacgccccgggggtc
cagatgcaggccatccccgaggacgctgtgcaggaggacagtggagacgaggaggaggat
gaccccaacaaacgcatctcgatccgtgctcacgacaagaggatagcgtgtgaggaggag
ttctctgattctgaggatgaaggcgaaggaggccgcagaaacgcagccagcttcaagaaa
gccaagcgagccaagactgaaggagagaaggagggagaagaaaaggagaagaagactgag
gaggaaacgaaagaagtcaaagaagaagagaaggcaccagaggaggagaaaatggacaca
tcaaagcctaaggaagagtccaagacgccttga

DBGET integrated database retrieval system