KEGG   Notothenia coriiceps (black rockcod): 104947094Help
Entry
104947094         CDS       T04920                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104947094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 785 aa AA seqDB search
MPVSTRSIRERSAVGRFPTVTFGFGEDTEEEKEASEEDNAEQGNACQTWLRKICPCCCPQ
RNDVDITDTLITVTDYPSEVTDDKKPVAGDSELDELLLNVKSIDLMKGKSGENRTQHHTD
LYQSDAFIIRRGQNFHMWITLSRPFDPSTDKLHLDLKTGPLPTVSKGTHVIIPLVEKLEG
NRWEASIVSQDDKRMKLSVNSLPTALIGRYQIIVETHCANGQAVSTHDPANDIIMLFNPW
CEDDTVFMDAEDERQEYVLNDIGKIYYGTMDQIGVRTWDYGQFQDGILAACIFVLEKSGT
PPSGWGDPINVVRVVSAMINSPDDLGVVEGDWSGNYSAGTSPTVWSGSVEILNEYHKNNG
NPVKYGQCWVFAGVFTTVLRCLGIPGRTVTNFSSAHDTDVSLTTDVYLDENLDPIELLNA
DSIWNFHVWNDAWMARPDLPAGNGGWQAVDATPQETSQGTFRCGPAALTAVRNGQVFLKH
DVPFVFAEVNSDKIYWQKNTDGTFSQIYSEKKVVGHFISTKAVGTDERMDITHFYKHPEG
TEMERIAVETACSYGSKAEAYTYTKSQDVSIEVTMDGEGPKMGEDAELKIILRNSSSEER
KLTLHSQVAVMYYTGVHKATVKKDMTDLDLMPNEEKPLEWTMEYKDYKDQLVDQAALMLT
LTGRVKETQQVMATQFNFRLRTPDLILKPIGKAVVGEKMAVEISFTNPLTQVLKAVIFHV
EGLGLLTARKIHYGDIGSRASVSLTEHFVPTLPGPRKLLASLDCKQLTQVHGVTGITVEE
KNNGA
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtctcgacgcgatcgatcagagagcggtctgcagtgggtcggtttcctactgtc
acgtttggatttggggaggacacagaggaagaaaaggaagcctcagaggaggacaatgct
gagcagggaaatgcatgccagacgtggctgcgtaaaatctgcccgtgctgctgtccccag
cgaaatgacgtcgacattacagacactttgattacagtaactgattacccgtcggaagtg
acggacgacaagaagcctgttgccggtgacagcgagcttgatgaactcctcctcaatgtg
aaatcaatagacctgatgaaaggaaaatcaggggagaaccgcacacagcaccacaccgac
ctctaccaaagtgacgcctttattattcgcagaggacagaatttccatatgtggattact
ctgtctcgaccctttgaccccagcactgacaaacttcacctcgatcttaaaacagggccg
ctgccaacagtgtcaaaaggaacccatgtaatcatccctttggtggagaagttggagggc
aatcgttgggaggcttctattgtgagtcaggacgacaaaaggatgaagctgtctgtgaat
tctctccccacggcgctcattggccgatatcaaatcatagtggaaacgcattgtgcaaat
ggccaggcagtttctacacatgaccctgcaaatgacatcattatgctgttcaacccctgg
tgtgaagatgacacagtgttcatggatgctgaagacgagaggcaggaatatgtcctgaat
gatatcggaaaaatctactatggcaccatggatcaaattggagtgcggacctgggactat
ggacagttccaagatgggattcttgctgcttgtatctttgtcctggaaaagagtggaact
cctccgtcagggtggggagacccgattaatgtggtgcgagtggtctcagccatgatcaac
tccccagatgacctaggtgtcgtggaaggagactggtccggaaactattcggctgggact
agtccaacagtttggagtggaagtgtggaaatcctgaatgaatatcataaaaacaatgga
aaccctgttaagtatggccagtgctgggtctttgctggagtattcaccacagtcttacgc
tgtttaggcattcccggtcgaactgtgaccaacttcagctcagctcatgacacagacgtc
tccttgacaacagacgtatacctggacgagaacctggatcctattgagctcctcaatgct
gactctatctggaacttccatgtgtggaacgatgcctggatggcgcgtccagacttgcct
gcaggcaacggaggctggcaagctgtggacgccacgcctcaggagacgagccagggcacc
ttccgctgcggcccggcggctctcactgcagtacgcaatggacaggtcttcctgaaacat
gacgtcccatttgtgtttgctgaggtgaatagcgataaaatctactggcagaagaacaca
gatgggaccttcagtcaaatctatagtgagaaaaaggttgtgggccacttcatcagcaca
aaggctgttggaactgatgaacgcatggatatcacacacttttacaaacaccccgaaggc
acagagatggaacgtattgctgtggagacagcatgtagctatggctccaaagcggaggcc
tatacctataccaagtcacaggatgtctctatagaagtcaccatggatggtgaaggtcct
aaaatgggagaagacgcagagcttaaaattatattgcgaaacagcagctcagaggaacga
aagctcaccctgcacagccaggtggcagtcatgtactataccggggtgcacaaggcaaca
gtcaaaaaggacatgacagacttggacttgatgcccaatgaagaaaaacctttggagtgg
accatggaatataaagactacaaggaccaactggtagaccaggccgccctgatgctgacg
ctgaccggcagggtcaaggaaacacagcaggtcatggccacacagttcaatttccggctc
aggaccccagacctcatcctgaagcccatcgggaaagcggtggtaggagagaagatggca
gtggagatttcctttacaaacccactcacacaggtgttgaaagctgtgatattccatgtg
gaagggctgggcctccttacagctcgaaagattcattacggagatattggcagtcgtgcc
tccgtgtcactgactgagcacttcgtacccacactccccgggccgaggaaattactggct
tcattggactgcaagcagctcacacaggttcatggtgtgaccggcatcactgtggaggaa
aaaaacaatggcgcttaa

DBGET integrated database retrieval system