KEGG   Notothenia coriiceps (black rockcod): 104950183Help
Entry
104950183         CDS       T04920                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase, cytosolic isoform X1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00240  Pyrimidine metabolism
ncc00983  Drug metabolism - other enzymes
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    104950183 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    104950183 (tk1)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     104950183 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK Ribosomal_L40e ATPase_2
Motif
Other DBs
NCBI-GeneID: 104950183
NCBI-ProteinID: XP_010774968
LinkDB All DBs
Position
Unknown
AA seq 233 aa AA seqDB search
MDCVDFPRVLPNSPRKARGQIQIIFGPMFSGKSTELMRRVRRFQIAQYNCLVIKYAKDTR
YSDAGVATHDKNIMEAVPANRLGELRPQALQACVIGIDEGQFVSFSDTVEFCEEMANLGK
IVIVAALDGTFQRKPFGNILNLIPLAESVVKLHAVCMQCYKEAAYTKRIGAEKEVEVIGG
TDKYQAVCRKCYGGLVVQKENSAPFKIETPQNTYGGKVVDSAFPRKLFSSLQL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggactgtgtggatttcccaagagttctgccaaattcaccaaggaaagcacggggacaa
attcagatcatctttggaccaatgttttcaggcaaaagcactgaattgatgaggagagtg
cgcaggttccagatagcccagtacaactgcttggtgatcaagtatgcaaaagacactcgt
tattctgacgcaggcgtggcaacacatgacaaaaacataatggaagctgtaccagccaat
cgtcttggagagttgcggcctcaggcattacaagcctgtgtcattggaatagatgaagga
cagtttgtaagtttttcagacacagtggagttttgtgaagaaatggccaatttagggaag
atagtcattgtagctgccttggatggaacctttcagagaaaaccctttggaaatatcctg
aacctcatccctctagcggagagcgtggtgaagctccacgccgtctgcatgcagtgttac
aaagaggctgcctacaccaagaggataggagcagagaaggaggtggaagtgattggtgga
actgacaagtaccaggcggtgtgtagaaagtgttacggaggtctggtggtgcaaaaagag
aacagcgctcctttcaagatcgaaactccacaaaacacctacggaggaaaagttgtggac
tctgcgtttcccaggaagcttttctcctctctccaactttga

DBGET integrated database retrieval system