KEGG   Notothenia coriiceps (black rockcod): 104954958Help
Entry
104954958         CDS       T04920                                 

Definition
(RefSeq) trypsin-1-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104954958
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     104954958
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104954958
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104954958
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MKSLVFALLLGAVFATEDDKIVGGQECVPHSQPHQVSLNSGYHFCGGTLVNENWVVSAAH
CYKSKMDIVLGDHNRWFMDGNEQIISAERVIPHPNYDSWLVNNDIMLIKLSQPATLNKYV
QPVALPSSCAPAGTMCTVSGWGVTMSSAVDSNRLQCLNIPILSREDCDNSYPDMITDAMF
CAGDLEGGKDSCQGDSGGPVVCDGELQGVVSWGFGCAEKNHPGVYAKTCIFTDWLQSTMA
SY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctctggtctttgctctgctcctaggagctgtgtttgccacagaggatgacaag
attgttggagggcaggagtgcgtgcctcactctcagccccatcaggtgtctctgaactct
ggctaccacttctgcggaggcaccctggtcaacgagaactgggtggtgtctgctgctcac
tgctacaagtccaaaatggacatagttctcggtgatcacaaccgctggttcatggacgga
aatgaacagatcatctctgctgaacgcgtgatccctcatcccaactacgattcctggttg
gttaacaatgacatcatgctgatcaagctgagccaacctgccaccctcaacaagtatgtg
cagcccgtggctctgcccagcagctgtgcccccgctggcaccatgtgcaccgtctccggc
tggggggtgactatgagctccgctgttgacagcaacaggctgcagtgcctgaacatcccc
atcctgtctcgtgaagactgtgataactcctaccctgacatgatcactgatgccatgttc
tgcgctggagacctggagggaggcaaggactcctgccagggtgactctggtggtcctgtt
gtgtgtgacggtgagctgcagggtgttgtgtcatggggctttgggtgcgcagagaagaac
cacccgggggtctacgccaagacctgcattttcacagactggctgcagagcaccatggca
tcttactga

DBGET integrated database retrieval system