KEGG   Notothenia coriiceps (black rockcod): 104955826Help
Entry
104955826         CDS       T04920                                 

Gene name
pcsk2
Definition
(RefSeq) neuroendocrine convertase 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     104955826 (pcsk2)
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S8: subtilisin family
   104955826 (pcsk2)
Chaperones and folding catalysts [BR:ncc03110]
 Intramolecular chaperones
  Subtilisin family
   104955826 (pcsk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 641 aa AA seqDB search
MCGSPRHGTAVGFIVLLNALLLATQAAEGVSTDHLLVQLHEGAQDEAHQLATQHGFHSAR
KLSFGEGLFHFYPQDTSKRRSKRSARSKQRLQKDSRVKNVVEQEGFDRQKRGYRDINDIE
VNMSDPLFTKQWYLINTGQADGTPGLDLNVAEAWKLGYTGKGVTVAIMDDGIDYLHPDLA
SNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGI
RMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRG
GKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNG
RKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALAIEANPDLTWRDMQHLSVLTSK
RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMSKEWKTVPERFHCIAGSIQDVHK
VQSGNKVLLTINTDACQGKDNFVRYLEHVQAVVTVNASRRGDLTINMTSPMATKSLLLSR
RPRDDDAKVGFDKWPFMTSHAWGEDPRGTWVMEVGFQGDEPQRGALKEWTLMLHGTQSAP
YIDQIVRDYQSKLAMSKKEELEEELDEAVERSLKSLLSKNN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatctccccgccatgggacagccgtgggatttatagtgctgctgaacgcgctg
ctgctcgcgacgcaggctgcagaaggagtctctacggaccatctcctggttcagctgcac
gagggcgcacaggacgaggcgcaccaacttgcaacacaacatgggttccatagtgcccgc
aagctttcctttggagaggggctcttccacttctatcctcaagacacttcaaagaggcgg
agcaaacgcagtgctcgcagcaaacagcgtctccaaaaagacagcagggtaaagaatgtc
gttgagcaagagggttttgatcgtcagaagcgaggctacagagatatcaatgatattgaa
gtcaacatgagtgaccctctattcaccaaacagtggtatctgataaacacgggccaggca
gacgggacccctgggctggatctcaatgtggctgaagcttggaaactgggctacacgggc
aaaggagttaccgtcgccatcatggatgacggaatcgactatctacatcccgacctggca
tcaaattataatgctgatgccagctatgacttcagcagcaatgacccgttcccatttccc
cggtacacagacgactggttcaacagtcacggcacacgatgtgctggagaggtctctgct
gcagccaacaataacatctgcggcgtgggagtcgcctacaactcgaaggtggcaggtatc
aggatgttggaccagccctttatgactgacatcattgaggcgtcatcaatcagccacatg
ccccaggtgattgacatctacagcgccagctggggaccaaccgatgacgggaagacggtg
gacggaccccgagagctcacgctgcaggctatggctgacggagttaacaaggggcgcgga
ggaaaaggcagcatctatgtgtgggcatcgggagatggtggtagctatgacgactgcaac
tgtgacggttacgcctccagcatgtggacaatctccatcaactcagccatcaatgacgga
cgcaccgccctgtacgatgagagctgctcctccaccctggcatccacgttcagcaacgga
cgcaagaggaacccagaggccggcgtcgccaccacagacctgtatggaaactgcacgctg
cgtcactccgggacatcagcagcagctccagaggccgccggtgtctttgctctggctatt
gaggcgaaccctgacctgacatggagagacatgcagcatctgtcagtcctgacctccaag
aggaaccagctccatgacgaggtccaccagtggaggaggaacggcgtcggtctggagttc
aaccacctgtttggctacggtgttctggacgctgggggcatggtgaaaatgtccaaggaa
tggaagactgtgcctgagcgtttccactgtatagccggatccattcaggatgtccataaa
gtccagtctggcaacaaagtgttgctgaccatcaacaccgacgcctgtcaggggaaggac
aactttgtccgctacctggagcacgttcaagcggtggtcacggtcaacgccagccgccgc
ggcgacctcaccatcaacatgacctcccccatggccacaaagtctcttctgctgagcaga
aggccccgtgacgacgacgccaaggtgggcttcgacaaatggcccttcatgacctcccac
gcctggggcgaagacccccgcgggacctgggtcatggaggtgggatttcagggcgatgaa
ccccagcgcggagccctgaaggagtggactctcatgctgcacggaacacaaagtgcccct
tacatagaccagatagtacgtgattatcagtccaaactcgctatgtccaaaaaggaggag
ctggaggaggagctggatgaggctgtagagagaagtctgaagagcttgctgagtaaaaac
aactga

DBGET integrated database retrieval system