KEGG   Notothenia coriiceps (black rockcod): 104957061Help
Entry
104957061         CDS       T04920                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     104957061 (pcsk1)
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S8: subtilisin family
   104957061 (pcsk1)
Chaperones and folding catalysts [BR:ncc03110]
 Intramolecular chaperones
  Subtilisin family
   104957061 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 104957061
NCBI-ProteinID: XP_010782965
LinkDB All DBs
Position
Unknown
AA seq 769 aa AA seqDB search
MEVRCRPAMMCCVFAVLFSVVPRSLESSLADRQYLNEWAVEIPGGLDAAESIAKELDYKL
VRQIGALEDHFLFKHRNHPSRMKRSANHITRRLSEDDRVLWAEQQYEKRRSKRASLGGCR
DCPVDKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWN
HTDIYSNYDAAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRIISADLHNECTQTHTGTSASAPLAAGIFALALEQNPELTWRDLQHIVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPAVWKHAPEKKQCIVRDDS
FQPREIKAAGEITIEVPTKACAGQENAVQSLEHVQVEASIEYTRRGDLHITLTSPAGTST
VLLAERERDTSANGFRNWDFMSVHTWGEDPAGTWTLKITDTSGRMQNEGRIMSWKLILHG
TSEKPEHMKKARVYVPYNAVQNDRRGVEHMVDMLEEDPTKVPPPPKTPETAQAETEKEPR
NPSNPPYSPSLALLRLLQTAFNRQTPALQQPQSAPAWKKKEPSRSLSPPATRLPPQTLYQ
ALDLINKYRGPEDSVYSDYSDGFYSNKPYRHRDDRLLQALFEMIDNNRK
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagatgccgtccagcgatgatgtgttgtgttttcgcggtcctcttctccgtg
gttccccggtctctggagtcctctctcgcggacaggcagtacctgaacgagtgggcagtg
gagatccccggaggactggacgctgcagagtcgatcgccaaagagctggactacaaactg
gtccgacagatcggggccctggaagaccatttcttgttcaaacatcgcaatcatcctagc
agaatgaaacgaagcgccaaccacatcaccaggcggctgtcggaggatgatcgggtgctt
tgggcagagcagcagtacgagaaacgtcgcagcaagagagcgtctctcggggggtgcagg
gactgcccggtggacaagctgttcgatgatcctatgtggaaccagcagtggtacctgcaa
gacacacgcacttcctcctcgctgccgaaactcgacctgcatgtgatccccgtgtggcag
aaaggcatcacggggaaaggagtggtcatcaccgtgctggatgacggcctggagtggaac
cacacagacatctactccaactacgacgcagcagctagctatgacttcaacgacaacgac
cccgaccctttccccagatacgactccaccaatgaaaacaaacatggaaccaggtgcgct
ggtgagattgctatgcaggcagacaacaataaatgtggtgttggagtggcatacaactcc
aaggttggagggatccgtatgctggatgggatcgtgacagatgccatcgaggccagctct
attgggttcaatccaaaccatgtggacatctacagtgccagctggggaccaaacgatgat
ggcaagaccgtggagggcccaggccgcctggctcagaaggcatttgaatacggtatccag
aagggccgtggtgggaaaggctctatctttgtttgggcttcaggtaatggtgggcgccag
ggcgataactgtgactgtgatggttacacagacagcatctacaccatctcaatcagcagt
gcctcccagcagggtctgtccccctggtacgcagagaagtgctcctccaccctggctaca
gcctacagcagtggagactacaccgaccagaggattattagtgctgatctgcacaatgag
tgcactcagactcacacaggaacgtcggcctctgccccgctggctgctggaatatttgcc
ctggcactggaacaaaatccagaacttacatggagagacctgcagcacattgtggtctgg
acctcagagttcgatcctctagccaataacccgggatggaagaggaacggagcggggctg
atggtcaacagccgcttcggcttcggccttctcaacgccaaagccctggtggacctcgct
gacccggcggtgtggaagcatgcgcctgaaaagaagcaatgcatcgtcagggatgactct
ttccagcccagggagataaaagcagcgggggagatcacaatagaggtgccaaccaaagcc
tgtgccgggcaggagaacgcagtccaatccctggagcacgtgcaggtggaggccagcatc
gaatacaccaggagaggggacctacacataacactcacctccccagccggaaccagtaca
gtgctgctggctgagcgagagagggacacctccgctaatggcttcagaaactgggacttc
atgtctgtgcacacatggggagaagaccctgctggtacatggaccctgaagatcacagat
acatcgggtcgtatgcagaacgagggtcggataatgagctggaagctaattcttcatggg
acgtcggagaagccagagcacatgaagaaagctagagtgtatgttccctacaacgccgtg
cagaacgaccgccgtggtgtggaacatatggtcgacatgttggaggaggatcccacaaag
gtacctccacctccaaagactccagagactgcacaagctgaaactgaaaaggagcccaga
aatccctcaaacccaccttactccccctccctggccctactgcgcctccttcagacggcc
ttcaacaggcagaccccggccctgcagcagccccagtcagcacccgcctggaagaagaag
gagccgagccggagcctctctcctcccgcaacacggctcccccctcagacgctgtaccag
gctctggacctgatcaacaagtaccgaggccccgaggacagtgtctacagcgactactct
gatggcttctacagcaacaagccgtacaggcacagagacgaccgactgctgcaggccctg
tttgagatgatagataataatcgcaagtga

DBGET integrated database retrieval system