KEGG   Notothenia coriiceps (black rockcod): 104957801Help
Entry
104957801         CDS       T04920                                 

Definition
(RefSeq) beta-1,3-galactosyltransferase 5-like
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    104957801
Enzymes [BR:ncc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     104957801
Glycosyltransferases [BR:ncc01003]
 Glycan extension
  Glycolipid
   104957801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 370 aa AA seqDB search
MVGRGLWICKPRFGKRGRFGVLPYLCAAIASLALLALLFVDCIESWVTSMNMNTLVEPHA
AIIPPQSVPPTRPEEFLLMPSPLMCQRAKPYLITMVTSSPANQRARQAIRDTWGGEVEVR
GLRVMTLFMVGVASDPGLAKLLIEEARERGDLIQGRFLDTYSNLTLKTLSLLGWARRFCP
QAHFMAKVDDDVLFNPSALLHFLNRSRNPYEQGDLYLGRVHLHVAPDRDPDGKHYLPSGA
YPPSVFPDYCSGTAYVLSRSALLKISLAASASPLSTPLPPEDVFVGLCARTAGVLPSHCP
LFSGGPGVPYGRCCYQAMVSIHHVPPREMLHYWADVHISRPCSWLGIRASLGLCKVRAML
GTALGLEQGL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggtcggacgggggctgtggatatgtaagccccggtttggaaagcggggcaggtttggt
gttttgccttatctgtgcgcggcgatagcgagcttagccttactggctctgctctttgtg
gactgcatcgaatcatgggtcacctccatgaacatgaacacgttggtggagccgcacgca
gccatcatccccccgcagagcgtcccccccacccggcccgaggagtttctgctcatgccc
agcccgttaatgtgccagcgtgccaagccttacctcatcaccatggttacctcgtctcct
gccaaccagagggcccgccaggccatccgggacacctggggaggggaggtggaggtgagg
ggcttgcgcgtcatgaccctcttcatggtgggggtagcttctgaccccggactggccaag
ctgctgatcgaggaggccagggagcgaggagacctgattcaggggcgttttctggacacc
tactccaaccttaccctgaaaaccctgtccctgctggggtgggcccgcaggttctgcccc
caggcccacttcatggccaaagtggatgatgacgttctgttcaatcccagtgccctcctg
cacttcctgaacaggagtcgtaacccctacgaacaaggagacttataccttggcagggtg
catctccacgtggccccggaccgtgacccagatggcaagcattacctcccttcaggggcc
taccctccttctgtgtttccggactattgcagtggcacagcctatgttctgtcccgctcc
gcactgctcaagatttccctggcggcctctgcgtcacctctttccacacctctgccccct
gaggacgtgtttgttggtttgtgtgcccggacagctggagtgttgccctcacactgccca
ctcttctccgggggcccaggggtgccgtacgggcgctgctgctatcaggccatggtgtcc
atccaccatgtcccacccagggagatgctgcactactgggctgatgtccacatatctcgg
ccctgctcgtggctgggtatccgggcttctctggggctctgcaaggtcagggcgatgctg
gggaccgctctggggctggagcagggcttatga

DBGET integrated database retrieval system