KEGG   Notothenia coriiceps (black rockcod): 104958752Help
Entry
104958752         CDS       T04920                                 

Gene name
suv420h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104958752 (suv420h1)
Enzymes [BR:ncc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104958752 (suv420h1)
Chromosome [BR:ncc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104958752 (suv420h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 864 aa AA seqDB search
MKWLGESKNMVLNGRRHGNKLTSEQHVSQTRSQHSQRVSLRHSKNRSRRCSRRFIAASLE
AERRCVPSSGMTAKELCENDDLTTSLILDPYLGFQTHKMNTRFRPIKGRQEELKDIIERF
KKHDNLEKAFRALTTGDWSRNQFLHKTKAQEKLFKQHVFVYLRMFATDSGFEILPCNRYS
SEQNGAKIVATKEWKRNDKIEYLVGCIAELSESEENMLLRHGENDFSVMYSTRKNCAQLW
LGPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEYCECYTC
ERRGTGAFKSKAGLPVEVPVINSKYGLRETDKRLNRLKKLGEGNRSSDSHSVGSHTDVDS
QEMPKTHQSARKRTSSSGLKYKNRTQSRQTLSRALTTSCSKQGRVNNNRVPKRLKSQSKP
SLSKVQLRSRRRGAEPKALAKGETCQLGLRDSKVSLCKGVTVKKEKDGQELVQQTLGQRG
CLTRHAAKENGNLQHVQGSEGSQCSTYRTRRSTRTLVTAQEAAAGVKLEPSAMDGLSPVP
GGVVIKTEPADMEYHLHHGVGHEQPSLDSGYARTGSCTRRKRPTRTIKCEDSYDEPFMPV
AASHNTNFSDCGNMVLSFADRHRDYNGVSNGSKSLRRDKGKSSCRSQDKVKKKRQITRYD
AQLILENSTGIPKLTLRRRRDSSSSKTNDTKDPIGSSNLSASSVNSASSSKISIKFSKDH
DKDKGSSYIAKLNNGFSPGVHSNSTKLKFQLKREDDARRISQTKADQMSFNGDMGQSLDS
RNGGHRTQKVMAEPSSSSSSSSSSEEDTDDEEEEDDDDYFDNEFEDDFIPLPPAKRLRLI
VGKDSIDIDISSRRREDQSLRLNA
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctaggcgaatccaagaacatggtattaaatggcagacgacacggaaacaag
ttgaccagcgagcaacatgtgagccagactcgctcccagcactcacagcgagtgtccctg
cgacacagcaaaaacagaagtcggaggtgtagccgcaggtttattgcagccagcctggag
gcagagaggcgctgtgtgccctcgtcaggaatgactgccaaggagttgtgtgagaatgat
gacctgaccacaagcctcatcctggatccatacctgggttttcaaactcacaaaatgaac
accagatttcgaccaattaagggaaggcaagaagagcttaaggacatcatcgagcgcttc
aagaaacacgacaacttggagaaagctttcagagctttgacgaccggagactggtctcga
aatcaatttctccacaagacgaaagctcaagaaaagctcttcaagcaacatgtatttgtg
tatctgcggatgtttgccacagacagcgggtttgagattctcccttgtaatcgctattca
tcagagcaaaatggagctaaaattgtggcaacaaaggaatggaagagaaatgacaagatc
gagtacctggtgggatgcattgccgagctttcagagagtgaggaaaacatgctgctccgg
cacggggagaatgacttcagcgtcatgtattcaacccgtaagaactgtgcgcagctctgg
ctgggaccagctgcgttcatcaatcacgattgtcgaccaaactgcaagtttgtatcgaca
ggacgggacacagcctgtgtgaaggttttgagggacattgaaccaggagaggaaatctct
tgttactacggagacgggttttttggggaaaacaatgaatattgtgaatgctatacatgt
gaacgacggggcactggtgctttcaaatccaaagctgggctgccagtggaggtgccggta
atcaacagcaagtacgggttgcgggagacggacaagcgtctcaacaggctgaagaagctg
ggggaaggaaacaggagctcagatagtcactctgtaggctctcacaccgatgttgactct
caggaaatgccaaaaacacatcaatctgccagaaaaagaacatcatcttctggcctgaag
tataaaaacaggactcaatccagacagactttgtcaagagcccttactacctcatgttca
aaacaaggtcgtgtaaacaataacagggtaccaaagagactaaaatcccaatccaaacct
tcactaagtaaagtccagttgcggagtcgcagaaggggtgcagagcccaaggcgttggcc
aaaggagagacttgccagctgggtctcagggactcaaaggtgtcgctgtgtaaaggcgtc
accgtgaagaaggagaaggatggacaggagctggtgcagcagacattgggccagcggggc
tgcctcacccgtcatgctgccaaggaaaatggcaatctacaacatgtgcaaggtagtgag
ggcagtcagtgttcgacgtacagaactcgcaggtccacaaggaccctggtaacagcccag
gaagctgcagctggtgttaagctagagcccagtgctatggacggcttgagcccagtccct
ggtggagtggtcattaaaacagagccagctgacatggagtaccacctccaccatggggta
ggacatgagcagccatcgttagactctggctatgccagaacaggctcatgcaccaggcgg
aaacggccaacacgaacaattaaatgtgaagactcgtacgacgagccgttcatgccggtg
gctgctagtcacaacactaacttctctgactgtgggaatatggtgttgagcttcgccgac
cggcatagggactacaacggggtttcgaacggcagcaaatcccttcgcagggacaagggc
aagagtagctgtcggtcacaggacaaagtgaaaaagaagcgtcagatcacgcgatatgac
gcccagctgatcctggagaacagcacaggtatccccaaactgacgctccgccggcggagg
gacagcagcagtagcaagaccaacgacaccaaggaccccattggctcctccaacctctct
gcctcttcggtcaactcggcctcttccagcaaaatcagcatcaagttcagcaaggaccat
gacaaggacaaaggcagctcatacatagccaaactaaataacggattttcccccggggtc
catagcaactccaccaagctgaagttccagctgaagagggaggacgatgcacggaggata
tcccagaccaaggcggaccagatgtcctttaacggggacatgggccagagtctggactcc
aggaatggtggacatcggacccaaaaggtcatggctgagccctcctcatcgtcgtcctca
tcgtcatcttcagaggaggacacggacgacgaggaagaggaggatgacgatgactacttc
gacaatgagttcgaagacgatttcattccacttcctccagcgaagcgcctccgactcatt
gtgggtaaagactcgatagacatcgatatctcctccaggaggagagaggatcagtccctg
aggctcaatgcataa

DBGET integrated database retrieval system