KEGG   Notothenia coriiceps (black rockcod): 104960688Help
Entry
104960688         CDS       T04920                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104960688
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     104960688
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104960688
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104960688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 104960688
NCBI-ProteinID: XP_010787141
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MKALIFLALLGAAFAAEEEKVVGGYECPRNSVPYQVSLNAGYHFCGGSLISSQWVVSAAH
CYKSRIQVRLGEHNIAANEGTEQWIDGVKMIKHPQYNSYNLDNDIMLIKLSRPATLNSNV
QTVALPKRCPQADENCMVSGWGNLSVNGNDFPDRLQCLRQPIIDDRICKNAYPHLLTDNM
LCSGFMSGGASSCQGDSGGPLVCNGQLQGVVSWGYDCAMQGHPSVYARVCRYNSWISSTM
SNN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccctgatattcctggctctgcttggagcagcgtttgctgctgaggaggagaag
gttgtcggcgggtacgagtgtcccagaaactcggttccctaccaggtgtctctgaacgct
ggataccacttctgcggaggatccctcatctccagccagtgggtggtgtctgctgctcac
tgctacaagtctcgtatccaggtccgccttggcgagcacaacatcgctgcgaacgagggc
acggagcagtggatcgatggagtcaagatgatcaagcacccacagtacaacagctacaac
ctggacaacgacatcatgctgatcaaactgagccgccccgccaccctcaacagcaacgtc
cagaccgtggccctgcccaagcgctgcccccaggccgacgagaactgcatggtgtccggc
tggggcaacctctccgtcaacggaaacgacttccctgacaggctgcagtgtctgaggcag
cccatcatcgatgacaggatctgcaagaacgcctacccccacctcctcaccgacaacatg
ctttgctccggtttcatgagcggaggtgccagcagctgccaaggagactctggtggtcct
ctggtgtgtaacggtcagctgcagggggtcgtgtcctggggttatgactgcgccatgcag
ggacatcccagcgtctacgcccgagtgtgccgctacaacagctggatcagcagcaccatg
tccaacaactaa

DBGET integrated database retrieval system