KEGG   Notothenia coriiceps (black rockcod): 104960694Help
Entry
104960694         CDS       T04920                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104960694
  Amino acid metabolism
   00310 Lysine degradation
    104960694
   00380 Tryptophan metabolism
    104960694
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     104960694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1016 aa AA seqDB search
MSQFRALVGVLRGGRAGGSQWLRACGGAPARRWVDPRRGCSSGAAPVLSTVAGSSSYMEE
MYIAWLEDHKNVHESWDAFFSNIHASRPPGEAGERRPSALLEGRVLSHSANMAQKVVEDH
LAVHTLIRAYQIRGHHVAQLDPLGILDADLDHFVPSDLITTIDKLGFYGLDESDLDRSFQ
LPSTTFIGGEDTTLPLREIIRRLEASYCGHIGIEFMFINNVDQCQWIRQKFETPGILQFT
KLEKRTLLARLIRSTRFEDFLARKWSSEKRFGLEGCEVLIPALKSMIDTSSSAGIDSVIM
GMPHRGRLNVLANVIRKELDQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRETDKNIA
LSLMANPSHLEAVDPVVQGKAKAEQFYRGDTQGKKVMSILIHGDAAFAGQGVVYETFHLS
ELPSYTTHGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVC
RVAAEWRATFNKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKQIRRQEHVLKKYSDRLIAE
GVVTLQEYEEEVAKYDKICEEAYASSKDEKILQIRHWLDSPWPDFFTAEGEPKSMSSVPT
GLKEEVLQHIGQTASSVPLDDFKIHPGVSRILRSRADLVKNRQMDWALGEYMAFGSLLKD
GIHVRLSGQDVERGTFSHRHHVLHDQEVDKRICVPMNHLWADQAPYTVCNSSLSEYGVLG
FELGFAMASPNALILWEAQFGDFNNTAQCIIDQFISPGQAKWVRNNGIVLLLPHGMEGMG
PEHSSARPERFLQMSNDDPDHFPEFSGDFEVQQLYDCNWIVVNCSTPANYCHVLRRQILL
PFRKPLIIFSPKSLLRHPDARSSFEDLAEGTKFKRLIPDVGPASQNPSQVKRVIFCAGKV
YYELARERKQQKLEKEIAIIRLEQISPFPFDLVRTEAEKYRNAELVWCQEEHKNMGYYDY
ARPRLLTVTANRRPVWYVGRDPAAAPATGNKFTHFNELKRFMDTAFNLNAFTGKDL
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtttagggcgttagtgggtgtgctgaggggagggcgtgctggggggagtcag
tggctgcgagcctgtggaggggccccggccaggcgctgggtcgacccccggagaggctgc
tcctccggggccgcgccggtcctctcaacggtggccggtagctccagctatatggaggag
atgtacattgcctggctggaggatcacaaaaatgtccatgagtcctgggacgccttcttc
agtaacatccacgcctccagaccacctggcgaggcgggtgagagacgcccctccgctctg
ctcgagggccgagtgctgtcccactcagcaaatatggcccagaaagtggtggaagaccac
ctggccgtgcacactctcattagagcctatcagattcgtggtcaccatgttgcgcagtta
gaccctttgggaatcctagatgctgatttggaccactttgttccatccgacttgatcacc
accatcgataaattaggtttctacggtcttgatgagtctgacttggacaggagctttcag
ctgccctccaccaccttcatcggaggagaagataccactcttcctctaagagaaatcata
cgcagacttgaagcatcctactgtggtcacatagggatagaatttatgttcatcaacaac
gtggaccagtgtcagtggatccgtcagaaatttgagaccccgggaatactgcagttcact
aaacttgagaagaggactttgctagcccgcctgatcagatccacacggtttgaggacttc
ctggcaagaaaatggtcttcagagaagcgttttggtctggagggctgtgaagtgctcatc
ccggctctaaaatccatgattgacacgtcgagctctgccggcatcgacagtgtgatcatg
gggatgcctcatcggggtcgactgaatgtgttggccaatgtgattcgtaaggaactggat
cagatcttctgtcagttcgaccccaagttagaggcgtctgatgaggggtcaggggatgtg
aaataccaccttgggatgtaccacgagaggattaaccgagagacagacaagaacatcgca
ctgtcactcatggcaaacccctcccacctggaggccgtggatcctgtggttcagggcaaa
gccaaagccgagcagttctacagaggagacactcaggggaagaaggtgatgtccatcttg
atccacggtgatgctgcttttgctggacaaggagttgtttatgagacgttccacctgagc
gagctcccctcctacaccacacatggtacaatccatgtggtggtcaacaaccagattggc
ttcaccacagaccctcgaatggcccgctcctcgccctaccccaccgacgtggctcgggtt
gtcaatgctcccatcttccatgtgaatgctgatgaccccgaggctgtcatgtatgtttgc
cgggtggctgcagagtggagggccaccttcaataaagatgtcgtcattgacctggtttgt
tacaggcgatttggacataacgagatggacgaacccatgttcactcagccactgatgtac
aaacagatccgtcggcaggagcatgtgctgaaaaagtactctgaccggctcattgcggag
ggagtggtgactctgcaagaatatgaggaagaagttgctaaatatgacaagatatgtgaa
gaggcatacgccagctccaaggatgaaaagattttacaaatccgacactggctcgactcc
ccgtggccagatttcttcacagcagaaggagagcccaagagcatgagcagcgtccccaca
ggactaaaggaggaggtcttgcagcacattggccagacagccagctctgtgcccctggat
gactttaagatccaccctggagtgtctcgtatcctgcgtagtcgagctgacctggtgaag
aaccggcagatggactgggctctaggagaatacatggcctttggttcccttctcaaagat
ggcatccatgttcgactcagtgggcaggatgtagagcgaggcacctttagtcaccgtcat
catgttctccatgaccaagaggtggacaaacgtatctgtgttcccatgaaccacctgtgg
gccgaccaggctccctacacggtctgcaacagctccttatccgagtacggagtgctaggt
tttgagcttggcttcgccatggccagtccgaatgctctgatcctctgggaggcccagttt
ggagacttcaacaacacagcccagtgcatcattgaccagttcatcagcccgggccaggcc
aagtgggtccgcaacaatggtattgtcctactgctgccacatgggatggagggaatgggc
ccagaacattcatcagctcgacctgaacgcttcctacaaatgagtaacgatgatcctgat
cacttccctgagttcagtggagattttgaggtccagcagctgtacgactgtaactggatc
gtggtcaactgctccacgcctgcaaactactgtcacgtgctcagacgtcagattctgctg
ccattcagaaaaccgctgatcattttcagtcctaagtccctgctgaggcaccctgatgca
aggtcaagttttgaagacctcgctgaaggtactaaattcaagaggttgatcccagatgtt
ggccctgcaagtcaaaacccatcccaggtgaagagggtgatcttctgtgctggcaaagtc
tactatgaactggctagagagaggaaacagcaaaaactggagaaagagatcgccatcatc
agacttgaacagatctctccattcccgtttgacctggtcagaaccgaggcagagaaatat
agaaacgctgagctggtctggtgtcaggaggagcacaagaacatgggttactatgattac
gcccggccacgtctcctcacagtgacggccaacaggagacccgtttggtatgtgggacgg
gaccctgcagctgctcctgcgacaggaaacaagttcacccactttaatgagctgaagagg
ttcatggacacagctttcaacctgaacgccttcaccgggaaggacttgtaa

DBGET integrated database retrieval system