KEGG   Notothenia coriiceps (black rockcod): 104964156Help
Entry
104964156         CDS       T04920                                 

Gene name
gpd2
Definition
(RefSeq) LOW QUALITY PROTEIN: glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    104964156 (gpd2)
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     104964156 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 739 aa AA seqDB search
MAFRKALKHTAMVGGGAVATVFGLSQLIEYRKTQHGLARLAHVAAEAELRVPFADEFPSR
QAQLAALQNTEEFDVLVVGGGATGAGCALDAVTRNLKTALVERSDFSSGTSSRSTKLLHG
GVRYLQKAIMQLDYEQYMMVKEALSERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWAGI
KMYDLVAGGQCLKSSYVLSKAKALEHFPMLKKDKLVGAIVYYDGQHNDARMNLAIALSSV
RYGAAVANYTEVMHLLKTKDPQSGKEKVCGARCRDVITGHEFDVKAKCVINATGPFTDSL
RKMDNQETKNICQPSAGVHIVIPGYYSXCRPPRPQSLDNMGLLDPATSDGRIIFFLPWEK
MTIAGTTDSPTSVTAHPIPGEDDINFILREIRNYLSPDVEVRRGDVLAAWSGIRPLVTDP
DSKDTQSICRNHIVSISDSGLVTIAGGKWTTYRSMAEETLDAAIKAHGLSAAPCKSVGLT
LEGGKGWTPTLYIRLVQDYGLENEVAKHLAATYGGKAFDVAKMAQVTGQRWPIVGKRLVS
EFPYIEAEVLYAVREYACTATDVIARRTRLGFLNVQAADEALPRIVQIMGKELDWSEEKK
TEELETARKFLYLEMGYRSRAEQLTKTTEINLDTQEVARYKKRFHKFDKESKGFITTVDV
QQVLESINVQIGENALHEILNEVDLNKNGQVEIDEFMQLMSAVKKGQVSDSRLAILMKTA
EETLDKRGPVTVDRSGGGF
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaggaaggctctgaaacacacggcgatggtcggcgggggggcggtcgccacc
gttttcggcctctcgcagctcatcgagtacagaaagacgcagcatggattggctcggtta
gcccacgtggcagcagaggcggagctgagggtccccttcgccgatgagttcccctcccgg
caggcgcagctggcggcgctgcagaacaccgaggagtttgacgtcctggtggtcggggga
ggggccacgggggccggatgtgccttagacgctgtcacacgcaacctcaagaccgctctg
gtagagagaagtgatttctcctcggggacaagcagtcggagtaccaagctactccacggg
ggggtccgctacctgcagaaggccatcatgcagctggactacgaacagtacatgatggtg
aaagaggccctcagtgagcgagccaacctcctggagatcgcccctcacctctctgcgccc
ctacccatcatgcttcctgtttacaaatggtggcagttgccttactactgggcggggatc
aagatgtacgacctggtggcgggggggcagtgcctgaagagcagctacgtcctcagtaag
gccaaggccttggagcatttccccatgctgaagaaggacaagctggtgggagccatcgtc
tactacgacggacagcacaacgacgcccgtatgaacctggccatcgcgctgtcgtcggta
cgctacggggccgccgtcgccaactacaccgaggtgatgcacctgctgaagaccaaagac
ccccagagcgggaaggagaaggtgtgcggggcccgctgcagggacgtcatcacaggacat
gagtttgacgtgaaggccaagtgtgtgatcaatgccacggggccgttcacagactctctg
aggaagatggacaaccaggaaactaagaacatctgccagccgagcgccggagtgcacatc
gtcatccccggctactacagctgatgtcgtcctccccgcccacagtccctcgacaacatg
ggtcttctggatccagcgacgagtgacggacgcatcatcttcttcctgccctgggagaag
atgaccatagctgggacgaccgactcccccaccagcgtgacggctcaccccatcccgggg
gaggacgacatcaacttcatcctgagggagatccgcaactacctcagccccgacgtagaa
gtgcggcgaggagacgtgttggcggcgtggagcggcatccggcccctggtgacagacccc
gactccaaagacactcagtccatctgcaggaaccacatcgtcagcatcagtgacagcggg
ctggtcaccatcgccggcgggaagtggaccacgtacagatcgatggctgaggagactctg
gacgcagccatcaaagcacacggcctctctgccgcgccctgcaaatctgtgggtctgaca
ctggaggggggcaagggctggacccccaccctctatatccgcctggtgcaggactacggc
ctggagaatgaggtggctaagcacctggcggcgacgtacggagggaaagccttcgatgtg
gccaagatggctcaggtcaccgggcagaggtggcctattgtcgggaagagactggtgtct
gagttcccttacatcgaggcggaggtgctgtatgcggtcagagagtacgcctgcacagcg
accgatgtgatcgctcggagaactcgcctcggcttcctgaacgtgcaggcggccgacgaa
gcgctccctcgcatcgtgcagatcatggggaaggagctggactggagcgaggagaagaag
acggaagagctggagacagccaggaagtttctgtacctggagatgggctacaggtctcgc
gctgaacagctgaccaagactactgagatcaacctggacacccaggaagtagccaggtac
aagaagcgtttccataagtttgacaaagagagcaaagggttcatcaccactgtggacgtc
cagcaggttttggaaagcatcaatgtccaaataggtgaaaacgcactccatgaaatcctt
aatgaggtggacctcaacaagaacggacaggtggagattgacgagttcatgcagctcatg
agcgccgtgaagaagggacaagtgtccgacagccgcctggccatcctgatgaagactgcg
gaggagacgctggataaacgaggcccggtgacggtggaccggagcggggggggattctga

DBGET integrated database retrieval system