KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_23260Help
Entry
BZZ01_23260       CDS       T04905                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ncn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BZZ01_23260
Enzymes [BR:ncn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BZZ01_23260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARV61147
UniProt: A0A1Y0RPH0
LinkDB All DBs
Position
complement(5643480..5644976)
Genome map
AA seq 498 aa AA seqDB search
MTTPLTCRNYIAGQWVNAASRSTLESRNPADRRELVATFPRSAAIDVDTAVAAARKAYRT
WRLLPAPARAEYVFRVGELLQKYKEELAQLMSREMGKSLTEARGDVQEGIDCAFYNAGEG
RRLFGQTTPSEMPNKFAMTVRTPVGVCALITPWNFPIAIPCWKALPALVCGNTVVFKPAE
DTPACATKLIEIFVEAGLPEGVINLVHGVGEEVGKALVEHPDVDLVSFTGSSETGAFVAS
TCGQTHKRVCLEMGGKNAQIVMEDADLELALDGAVWGAFGTTGQRCTATSRLILHRDIKE
KFTAMLKERTNKLRLGAGTDPKTDIGPVINERQLQRVSQYLDIAREEGAKVLIGGEIVTE
AELEHGYFFEPTILDEVTPEMRVAREEIFGPVVAIIAVNSFEEAIAILNNTPYGLSSSIY
TRDINRAFVAMRDIEAGITYINGPTIGAEVHLPFGGVKQTGNGHREAGTAALDVFTEWKT
VYVDFSGSLQRAQIDNRS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccactccactgacttgccgcaattatatcgctggtcaatgggtaaatgctgcatcg
cgaagcactctagaaagccgcaatcctgctgatagacgcgaactggttgctactttcccg
cgttctgcagcaattgatgttgatacagcagtagcagccgcccgcaaagcataccgaact
tggcgactcctccccgccccagcgagagcagaatatgtatttcgagtaggagaactttta
caaaagtataaagaagaacttgcccagctaatgagtcgagaaatgggtaagtccctgaca
gaggcgcggggagatgttcaagaaggaattgactgcgctttttacaatgctggtgaagga
cggcgactgtttggacaaacgacaccctcggaaatgccgaataaattcgcgatgacggta
agaacgcccgttggggtgtgcgccctcatcactccgtggaatttccccattgctattccc
tgctggaaagctttgccggctttggtatgcggtaatactgtagtcttcaaacccgctgaa
gatacccccgcttgtgcaaccaaactcatcgagatttttgtagaagcaggtttgccggaa
ggtgttatcaatctggtgcatggagtcggcgaagaagtggggaaagctttagttgagcat
cctgatgttgatttggtctcttttactggatcttctgaaacgggtgcttttgtcgcctca
acctgcggacaaactcataaacgcgtctgtttagaaatgggtggcaaaaatgctcaaatt
gtgatggaagatgcagacttagaacttgctctagatggcgcagtttggggagcattcgga
acgaccggtcaacgatgtactgcgacgagtcgcctgatcctgcaccgcgacatcaaagag
aaatttaccgctatgctcaaagagcgcaccaacaagttacgcttgggtgcagggactgat
cccaaaactgatatcggtccagtgattaacgaaaggcaactccaacgggtgagtcagtat
ctagatattgcccgagaagaaggtgcaaaggtgttgattggtggagaaatagtcaccgag
gcagaattagaacacggttacttctttgaaccaactattcttgatgaagtgactcccgaa
atgcgcgttgcccgtgaagagatattcggacctgttgtagcgattatagcggtgaactcg
tttgaggaggcgatcgccattctgaacaatacgccttatggtctttcttcttccatctac
actcgtgatatcaaccgcgctttcgttgctatgcgcgatatcgaagcaggaatcacttac
atcaatggtcctactattggcgcagaggttcatttaccctttggcggtgtcaaacaaact
ggaaacggacaccgggaagctggtacagctgcattggatgtgtttacagaatggaagaca
gtgtacgtagatttttcaggaagtttgcaacgtgcccaaatagataaccgtagctag

DBGET integrated database retrieval system