KEGG   Nitrosomonas communis: AAW31_03995Help
Entry
AAW31_03995       CDS       T03942                                 

Definition
(GenBank) hypothetical protein
Organism
nco  Nitrosomonas communis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
915050..917893
Genome map
AA seq 947 aa AA seqDB search
MPFNIDSQSDVEKLLGIVRDLVHELRPNEPVPKHLGLDHSLERDFGLDSLARVELLSRIE
RELGLKLGEKALAEAETPRDLLKQIAGTSTAETLTPAGTAKFAETQVYPPPPETASTLIE
ILDWRVARQPEQVHITLYGEEEHTEDITYRRLQEEAKALAAGLQQLGLGSGERIAIMLPT
GRGFFAAFYGALYAGCVPVPLYPPGRPSQIEDHMRRIANIIGNAQASILITVEQAKPLGH
LLRAQCESLRMVTTVADLSIHGAHPPSPKLEPQSIALLQYTSGSTGSPKGVVLTHANLIA
NLRAMTLASSITAADIFVSWLPLYHDMGLIAACMGSLYVGFRLVLLSPLSFLARPACWLW
TINRHCATVSAAPNFAYELCANKLDDRELNGLDLSCWRLAYNGAEPISVNTIEHFVARFS
RYGFSRTAMTPVYGLAESSVGLAFPPAERGPLVDHVDRDTLLHSGIARCVQAEDRSALHI
VSCGLPLPDHQIRIVDADGQVLAERTQGRVQFRGPSATSSGYFCNPEATARLFDGQWLNS
GDMGYIAARELYLTGREKDIIIRGGHNIYPQELEEAVSKVRGIHKGGVAVFPASNTHAGT
ERLIILAETHESSTKERERIVTEINNLAVDLVGLPADDIVLVPPRTVLKTSSGKLRRTAC
RELYEQGAINSTLRPLWWQMIRLGGAAAIARVMRLLRRGDEWAWGLWAWAVFVAIVPFAW
LLIVLMPGLTLRRRIARASARLAVALTGLKLQEEGLQHLKSEAPMVVVANHASYLDALLL
TAVLPAKFAYVAKQELLRNPAAAIPLRRLGSAFVERFDDARGVEDERKLEERARAGESIV
FFPEGTFRREAGLMPFRMGAFLTAARTGIPILPVTLIGTRTMLCAGQWLPRRSKLKVLIS
TPLHPLGNDWQAALQLQEAARRQILAELSEPDIIIAAGPTSSSENFR
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcaatatagattctcaaagcgatgtagaaaagctgcttggcattgtgcgcgac
cttgttcatgagctgcggccgaatgaacctgttcccaaacatctcgggttagatcattca
ttggagcgcgacttcggtctagacagcctggcgcgcgtagagctgctaagtcgcatcgaa
cgagaactgggtttaaagcttggcgaaaaagcgctggctgaggccgagacacctcgtgat
ttgctcaagcagattgcaggtacgagcactgccgaaacacttactccagctggaacagcg
aagtttgcagaaacccaggtatatcctcctccgccggaaaccgcgtctacgctgatcgaa
atcctagactggcgtgtcgcgaggcaacctgagcaggttcatatcacgctttatggcgaa
gaggagcataccgaagacattacctatcgcaggttgcaggaagaggccaaagcgttggct
gccggcctgcaacagcttgggctaggttctggcgaaaggatagctatcatgttgcccact
gggcgaggattcttcgcagctttttatggtgcactctatgctggatgcgtaccggtaccg
ctgtacccgccgggccgaccttcgcaaattgaggatcacatgcggcgtatcgccaatatc
atcggcaatgcccaagccagcattctcatcacagttgagcaagccaaaccactgggacac
ttgctgcgtgcgcaatgcgaatcactccgtatggttacaaccgtcgcagatttgtctatc
catggagcgcaccctccttctccgaagttagaaccacaaagtatcgctttactgcaatac
acttctggcagtaccggcagccccaaaggagtagtattaacccatgctaacctaatcgcc
aacttgcgagcgatgacgcttgcttcgagcattactgccgcagatattttcgtctcatgg
ctgccgctctatcacgatatgggattaattgccgcttgcatgggtagcctctatgtcggg
tttcggctagtactgctctcgcctctcagctttcttgcccgaccagcatgctggttatgg
acgattaaccggcattgtgccacagtttcagcagctcctaattttgcctatgagttatgt
gccaacaagctcgatgatcgtgagctgaatggtctggatctcagttgctggcgtctggcc
tacaacggagctgagccaatcagtgtaaatacgatagaacattttgttgcacgcttttct
cgctatggtttcagccgtaccgccatgacgcctgtttatggcctggcagaatcgtctgta
gggctggctttccctccggcggaacgtgggccgctggttgatcatgtggatcgagatacg
ctcttacactcgggtatcgcgcgttgtgtgcaggctgaagaccgctctgcgctgcacatc
gtttcatgcggcttacctttacccgatcatcagatacgcattgtcgatgctgatgggcaa
gtactggccgaacgtacgcaggggcgcgtgcaatttcgcggaccgtcagcgaccagcagc
ggttatttctgcaatcccgaagcgacagcgcgcctgttcgacggacaatggcttaatagc
ggtgatatgggttacattgcggccagagagctgtatctcactggacgtgagaaggacatt
atcattcgcggtgggcacaacatttacccgcaggaactggaggaagcggtaagtaaagtg
cgtggcatccataaaggtggagtagccgtttttcccgccagcaatacacacgctggcaca
gaacgcttgataatacttgctgaaacacacgaaagcagcaccaaggagcgtgagcggata
gtaactgaaatcaacaacctcgcggtagacttggtggggctgccagcagatgatatcgtg
ctagtaccgccgcgcacggtgctgaagacctccagtggcaagcttcgccgtactgcttgc
cgtgagctttatgaacaaggtgcgatcaacagcactctacgaccactatggtggcaaatg
atacgccttgggggtgctgcagccatagcgcgggttatgcgtttgctgcggcgcggtgat
gaatgggcatgggggctgtgggcctgggcagttttcgttgctattgtgcccttcgcctgg
ctgctgatcgtgctgatgcctggacttactctgcgccggcgcatcgcccgggcaagtgca
cgtctagcagttgcgctaaccggtctgaagctacaggaggaaggcttgcagcatctcaag
agcgaagcgcccatggttgtggtagccaatcacgccagctatctggatgcactcctactt
accgcagtactgcctgctaagttcgcctacgtggccaaacaggaattactgcgcaatccg
gcagctgctatccccttgcgtcgattaggcagcgcatttgttgaacgtttcgatgacgca
cgcggggtagaagatgaacgcaagctggaggagcgggcgcgcgcaggtgagtctatagtt
tttttcccagaaggtacatttcggcgtgaagccgggctgatgccgttcagaatgggagca
tttctgactgctgcacgcaccggtatccccatactaccagtcaccctgatcggcacccgc
actatgctatgtgctggacaatggttgccacgtcgaagtaagctgaaagtgctgattagc
acacccttgcatccattaggaaatgactggcaagcagcattacaattacaagaagcagcg
cgccgccagatactggcagagctgagcgaacctgatattatcattgccgctggaccaacg
tcatcaagtgaaaatttccgttaa

DBGET integrated database retrieval system