KEGG   Nitrosomonas communis: AAW31_07385Help
Entry
AAW31_07385       CDS       T03942                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nco  Nitrosomonas communis
Pathway
nco00473  D-Alanine metabolism
nco00550  Peptidoglycan biosynthesis
nco01100  Metabolic pathways
nco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AAW31_07385
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AAW31_07385
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AAW31_07385
Enzymes [BR:nco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AAW31_07385
Peptidoglycan biosynthesis and degradation proteins [BR:nco01011]
 Precursor biosynthesis
  Amino acid ligase
   AAW31_07385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST CPSase_L_D2 ATP-grasp RimK ATP-grasp_4 ATPgrasp_Ter TTL
Motif
Other DBs
NCBI-ProteinID: AKH37666
UniProt: A0A0F7KDR6
LinkDB All DBs
Position
complement(1612039..1612965)
Genome map
AA seq 308 aa AA seqDB search
MRVMRVPDYGKVAVLLGGRSAEREISLKSGAAVLEALLSEGVDAYPFDPAHQPMETLQQQ
GFNRAFIALHGRYGEDGSVQGALELMGLPYTGSGVLASALAMDKWRTKLIWQAVGISTPR
YLIIDAQSDFDEVAAYLDLPLIIKPAREGSTIGLSKIESKKDFSNAYQLAAQHDSIVLAE
QFIEGKELTAAILGETPLPLVRIEVTGELYDYHAKYVANDTRYFCPSGLPDELSRQLQAQ
ALQAHRILGCAGWSRVDLILDKNDQPYFLETNTSPGMTDHSLVPMAAKVAGIPFEELVVK
ILALSYVE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaatgcgtgtgcctgactacggaaaagttgcagtactgctaggtgggcgttca
gcagagcgtgaaatttcacttaaaagtggcgcggcagtacttgaggcgctgctaagtgaa
ggggtggatgcctatccttttgatccggctcatcagcccatggagacgctacagcaacaa
gggttcaatcgggcattcatcgcattgcatggccgttatggagaagatggttcagtccag
ggggctttggaactgatggggttgccttatactggcagtggtgttcttgcgagcgctctg
gcaatggataaatggcgtactaaactaatctggcaggccgtgggcattagtacaccccgt
taccttatcatcgatgcccaaagtgattttgatgaagtggcagcttatctcgatttacct
ttgatcattaagcctgcacgcgaaggctcaacaataggccttagtaagattgagtcaaag
aaagacttttcaaatgcttatcagttagcagcacagcatgattcgattgtattggcagag
caatttattgagggtaaggaattaactgccgctattctgggtgagacaccgttgccactg
gttcgtatagaagtgaccggagaactgtacgattatcatgcaaagtatgttgcaaatgat
acccgttatttttgtccaagcgggctgccggatgaactgagtcgccagttacaggcgcag
gctttacaggcacacagaattttagggtgcgcaggatggagcagggtagatttgatcttg
gataaaaatgatcagccttactttcttgaaacgaatacatccccaggcatgactgatcat
agccttgttccgatggctgcgaaagttgcaggtattccttttgaagagttagtcgtaaaa
attttggcattgtcctatgtggaataa

DBGET integrated database retrieval system