KEGG   Neurospora crassa: NCU04402Help
Entry
NCU04402          CDS       T01034                                 

Gene name
dim-5
Definition
(RefSeq) defective in methylation-5
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ncr  Neurospora crassa
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NCU04402 (dim-5)
Enzymes [BR:ncr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NCU04402 (dim-5)
Chromosome [BR:ncr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     NCU04402 (dim-5)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    NCU04402 (dim-5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Linkage Group IV; IV
AA seq 331 aa AA seqDB search
MEKAFRPHFFNHGKPDANPKEKKNCHWCQIRSFATHAQLPISIVNREDDAFLNPNFRFID
HSIIGKNVPVADQSFRVGCSCASDEECMYSTCQCLDEMAPDSDEEADPYTRKKRFAYYSQ
GAKKGLLRDRVLQSQEPIYECHQGCACSKDCPNRVVERGRTVPLQIFRTKDRGWGVKCPV
NIKRGQFVDRYLGEIITSEEADRRRAESTIARRKDVYLFALDKFSDPDSLDPLLAGQPLE
VDGEYMSGPTRFINHSCDPNMAIFARVGDHADKHIHDLALFAIKDIPKGTELTFDYVNGL
TGLESDAHDPSKISEMTKCLCGTAKCRGYLW
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcgttccgccctcacttcttcaaccacgggaagccagatgccaacccaaaa
gagaaaaagaactgccactggtgccagatccgatccttcgcaacccacgctcagctgccc
atctccatcgtcaaccgcgaagacgacgccttcctcaaccccaacttccgttttatcgac
cactccatcatagggaaaaacgttcccgtggccgaccagtctttccgagtaggctgctcc
tgcgctagcgatgaagagtgcatgtactcgacatgtcagtgtctcgacgagatggcgcca
gatagcgacgaggaagctgatccctacacccggaagaagcgatttgcctactactcccaa
ggagcgaaaaagggactattgcgtgatagggtcttgcaatcccaggagcccatctacgag
tgccaccaaggttgcgcctgttccaaggactgcccaaaccgagtggtagagcgtggccgg
accgtgcccttgcagatctttaggactaaagacaggggctggggcgtcaaatgccccgtc
aatatcaagagggggcaattcgtggaccggtacttgggcgaaatcattaccagcgaggag
gccgaccggcgacgagctgaatcgaccattgctagacgaaaggatgtctacttgtttgcc
ctcgacaagttttccgatccggactcactagatcccttgctggccggacagccgctagag
gttgacggcgagtatatgagtggccctaccaggttcatcaaccacagctgcgaccccaat
atggccatatttgcgcgggtgggcgatcacgctgacaagcatattcacgaccttgccctg
ttcgccatcaaggatatccccaaggggaccgagttgacattcgactatgtcaacggattg
acagggctcgaaagcgacgcgcatgacccatcaaagatctcggagatgaccaaatgtctc
tgcggaactgccaagtgcagaggctatctgtggtaa

DBGET integrated database retrieval system