KEGG   Neurospora crassa: NCU06264Help
Entry
NCU06264          CDS       T01034                                 

Gene name
mus-53
Definition
(RefSeq) mutagen sensitive-53
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
ncr  Neurospora crassa
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    NCU06264 (mus-53)
Enzymes [BR:ncr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NCU06264 (mus-53)
DNA repair and recombination proteins [BR:ncr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     NCU06264 (mus-53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Linkage Group III; III
AA seq 1050 aa AA seqDB search
MNTNRRSRSPDEEALEEDQHQYGAGTLSLEELDEHFPNRPRNHSKTFPFSDLFRTLFNPL
IDCKPSTSGGTVRGPKPGRGGHFSKVSYHEQRRHIIERFMSRWRSEVGNDFYPAMRLILP
DKDRDRGVYGLKENTIGKLLVKVMKIDRNSEDGYNLMHWKLPGGQSGVSRSVGDFAGRCL
EVVSKRAMRAQPGDLTIADVNVLLDRLAAASGEAEQLPIFEEFYRQMNAEEMMWLVRIIL
KDMRVGATERTFLNLWHPDAEALFSVSSSLRRVCWELFDPEFRLEQQETGIKLMQCFQPQ
LAQFQMTTTWEKLVKNLGVTEENPEFWIEEKLDGERMQMHMIEDDTVPGGFRFAFWSRKA
KDYTYLYGESLGDEQSALTRHLHKAFDDGVRNLILDGEMITWDIDIDKMVPFGTLKTAAL
EQQKNPSKAGPRPLYRVFDILLLNDKPLTEYTLNDRRRALERAVVGVHRRLEILPFERAT
SPDAIEPLLRRVVAEASEGLVLKNPRSRYSLNSRNNDWIKVKPEYMSDFGESLDCVVVGG
YFGSGRRGGTLSSFLCGVRVSQNFIKSGNASAEKCLSFVKVGGGFKAEDYAEIRHHTEGK
WQDWDPSSPPTEYIELGGGEKLQYEKPDVWIRPSDSVVISVKAASITQSDQFAMGWTLRF
PRFRKLRLDRAWDSALDMDEFEVLRSKIKDQEQERKKMEMENRKRKPATKRARKDLVIAG
MSDPSSSSAATPVIAPKETREASKRLFEGLDFCVLSDSLKPNKMTKPALEKLIKDHGGRI
HQQVMDHSGQGKIIIPIADKNVIKVASLRKANPEMDIIRPKWIFDCLVQPMPFTKQKENK
KGYLLPFEPTHLFHSGSEETSEEAEQAVDKFGDSYAGDLADINELKAIMEGMESDDYVSD
SDWDSDSGRGRGGGDGFDMNHFLDHLEEQGTSLDDLRSFMFRRCRVFFALPSAGNGDGAA
ESKALRLKNYIRFGNGKVVDELETATHVVVVTAPLGESSKKEEREIAAELRYKISLREMG
SPMPRIVKGEWVEDSWKEGTVVDEEEYVAG
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaacaggcgatccagatcgccagatgaggaggcattggaagaggaccaacat
cagtacggggcaggtactctaagcctagaagaacttgatgagcacttccctaacagacca
cgaaaccactccaaaaccttcccattctctgacctctttcgaaccctcttcaaccctctc
attgactgcaaaccctcaacctctgggggtacggtgcgcggccccaaaccaggacgaggc
ggccacttctccaaggtctcctaccatgaacagcgccggcacatcatcgagcgcttcatg
tcgcgctggcggtccgaagttggcaacgacttttacccggccatgcgcctcatcctcccc
gacaaggaccgcgaccgcggcgtgtatgggttgaaggagaacaccatcggcaagctgctg
gtcaaagtcatgaagattgatcggaactcggaggatgggtataacctcatgcactggaag
ctgccggggggccagagtggggtgagccggtctgtaggggactttgcgggccgctgtttg
gaagtggtcagcaagcgcgcgatgcgtgctcagccgggggacttgacgattgcggatgtc
aatgtcctgttggatcgcttggcggcggcaagcggggaggccgagcagttaccgatcttt
gaggagttttatcggcagatgaatgcggaggagatgatgtggttggtgaggatcatattg
aaggatatgagggtgggcgccacggaaaggacgtttctgaacctgtggcatccggatgcc
gaggcgctgttcagcgtttcgtcgagcttgcggagagtgtgttgggagctgtttgatcca
gagtttcggctggaacagcaggagacggggattaagctgatgcagtgctttcagccgcag
ctggcgcagtttcagatgacgacgacgtgggagaagttggtgaaaaatttgggggtgacg
gaggagaatccggagttctggatcgaggagaagttggatggcgagaggatgcagatgcat
atgatagaggatgataccgtgcccggaggatttcggtttgccttttggtcgagaaaggcg
aaggattatacttatctctatggtgagagcttgggagatgagcagtccgctctgacacgg
catctgcacaaggcctttgacgacggcgtgcgaaatttgattctcgacggagagatgatt
acttgggatatcgatatcgacaaaatggtaccctttggaacgctcaagacggccgcgttg
gagcaacaaaagaacccatccaaggctggtcctcgcccgctctaccgtgtctttgacatc
ctgctgctaaacgacaagccccttaccgaatacaccctcaacgaccggcggagagctctc
gagcgtgccgtcgtcggtgtccaccgccgcttggaaattcttcccttcgagcgagccacc
tccccagacgctattgagccactcttgcgacgagtcgtggccgaagcatcggagggtctt
gttctcaagaacccgcgctctcgctattcactcaacagccgtaacaacgactggatcaag
gttaaaccggagtacatgtccgactttggcgaatcactcgactgcgttgtggtgggcggg
tactttggctccggccggcgcggcggcacgctctcctccttcctctgcggtgtgcgcgta
tcccagaacttcatcaaaagcggcaacgccagcgccgagaagtgcctctccttcgtcaaa
gtaggcggcggcttcaaagcggaggactacgccgaaatccggcaccacaccgaaggcaaa
tggcaggactgggacccttccagcccaccaacggagtacatcgagctcggcggcggggaa
aagttacagtacgagaagccggacgtgtggatccgacccagcgactcggtcgtcatctcg
gtcaaggccgccagcatcacacaatcggaccagttcgccatgggttggacgctgcggttt
ccgcgcttccgcaaactgcggctggatcgcgcgtgggactcggcgctggacatggacgag
tttgaagtgttacgatccaaaatcaaggaccaggaacaggaaaggaagaagatggagatg
gagaaccgcaagcggaaaccggcgaccaagcgagcgaggaaggacctagttattgcgggg
atgtctgatccttcgtcttcttctgctgctacacccgtcatcgctccgaaagagacaaga
gaagcgagcaaacggttgtttgaaggcttggatttttgcgtcctttcggattctctgaaa
ccaaacaaaatgactaaaccggctttggagaaactcatcaaagatcacggtggtcgtatt
caccagcaggttatggaccactccggtcaggggaagatcatcatccccatagcagataag
aacgtgatcaaagtggctagtctgagaaaggcgaacccggagatggatatcatccggcct
aaatggatttttgactgtcttgtgcagccaatgccgttcacgaaacaaaaagaaaacaag
aagggctatctcctcccctttgagcccacccacctcttccactctggcagcgaagagacg
tcagaagaagccgaacaagcagtggataaattcggcgatagctacgccggggacttggca
gacataaacgagttgaaggcgatcatggagggtatggagtctgatgattatgtgtccgat
tccgactgggattcggactctggcagaggaagaggaggaggcgatgggtttgacatgaat
catttcctagatcacttggaagagcaggggacttcgttggacgatctacggtcgttcatg
ttccggaggtgtcgagttttctttgctctacccagtgctggtaacggagacggggcagcg
gaaagtaaagccttacgactcaagaactatatacgatttgggaacgggaaggtagttgac
gagctggagacggcgacgcatgtcgttgtcgtgactgctcctttgggggagagttcaaag
aaggaggagagagaaattgcggcggaattaaggtataaaattagcttgagagagatggga
agtccgatgccgaggatcgtcaagggggaatgggtggaggactcgtggaaggaggggacg
gtggttgatgaggaagagtatgtggctgggtga

DBGET integrated database retrieval system