KEGG   Neurospora crassa: NCU09805Help
Entry
NCU09805          CDS       T01034                                 

Gene name
gh13-2
Definition
(RefSeq) glycosylhydrolase family 13-2
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ncr  Neurospora crassa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCU09805 (gh13-2)
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NCU09805 (gh13-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I
AA seq 629 aa AA seqDB search
MRPERQLSVVLGLLLSAAVQVGALTSSEWRKQSIYQVVTDRFARSDLSTSAPCDTSQQVY
CGGSWQGLISKLDYIQGMGFTAVWISPIVKQIDGVTKDGSSYHGYWASDIWSLNPSFGTA
DNLKGLSKALHDRGMYLMVDVVTNHMAYLGCRSCINYQGLNPFSSQSYYHSPCTINYDNQ
TSIETCWQGSDVVSLPDLKTETDDVRKIWHDWVSKIVSTYSIDGLRIDSVKHVEKSFWPG
FESAAGVFAIGEVFQGDPAYLAPYQSYISGVLDYASYYWIVNAFQSTSGNITALANGMNI
LKAAAIDLSLYGSFLENHDQARFAHKTSDMVLAKNAIAFTMLKDGIPIIYQGQEQHYAGS
DTPYNREALWLSGFSTNSELYTWIKRLNQLRTHAIKKDDGYLTYRAWPIYSDSHTIAMRK
GSSNKQVVGVFTNVGASSSTAVTLSSLASGFSADEPVTDVVSCDSFITDSGGSITITLFG
GLPRILYSTTLLNGSDICSSRSAPTSTTSTNSGVPTSISSAASTSCTATAVPITFEALVS
TSYGETVKLLGNTTTLGSWNTANAVTLSASKYTSSNPLWYVSFDLAPGNVILYKFIKVNS
SGTVSWESDPNHKYTVPCAAATVSSTWRK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccgaaagacaactaagcgttgtcctcggactgctactctcagcggcggtccaa
gtgggagctcttacgtcttcagaatggcgcaagcagtccatatatcaggtcgtgacggat
cgttttgctcgaagcgatctgtcaaccagtgcgccatgtgacacatcccagcaggtatac
tgcggcgggtcatggcagggactgatctcgaagctggactatattcagggaatgggattc
actgctgtctggatatccccaatcgtgaagcagattgacggagttaccaaagatgggtct
tcttatcatgggtactgggcgtcagatatttggtccttgaatccttcatttggcaccgca
gacaacctcaaggggctctccaaagcgcttcatgaccgcggcatgtacctcatggtggat
gttgtcaccaaccacatggcgtatttgggctgccgttcgtgcatcaactaccaaggtctc
aatcccttctcttcccaatcttactatcactctccgtgcaccatcaactacgataaccaa
acctccatcgaaacatgctggcaaggaagtgatgttgtcagtttaccggacctcaaaacc
gaaaccgacgacgtccgtaagatatggcacgactgggtgtccaagatcgtgtcaacgtac
agtatcgatggccttcgtatcgatagtgttaagcacgttgaaaagtccttctggccagga
ttcgagtccgctgccggcgtgttcgccattggagaggtgttccaaggagacccggcgtat
ctggcaccgtaccagagctacatcagcggcgtcttggattatgcaagctattattggata
gtaaatgcgttccagtcaacaagcggcaacatcactgcgctggctaacggtatgaacata
cttaaagctgctgcgattgacctcagtctctacgggtcgttcctcgaaaaccatgaccag
gctcgctttgcgcacaaaactagtgatatggtcttagcaaagaacgcaattgcctttacg
atgctcaaggacggcatcccgatcatttatcagggacaggaacagcattatgcgggcagt
gatactccctacaaccgagaggccctctggctttccggcttttcaactaactcagagttg
tacacgtggattaaacggctgaatcagcttcgtacccatgctatcaaaaaagacgacggc
tacctgacataccgtgcatggcccatctactccgatagccacactattgccatgcgcaaa
ggttcatccaacaaacaagttgtgggcgtcttcaccaatgtcggagcgtcgtcctccacc
gccgtcactctgtcttcgttggcgtcaggattcagtgcagatgaacctgtcaccgacgtc
gtgagttgcgatagcttcatcaccgactctggaggcagcataaccatcacactttttggg
gggctcccaaggatcttatactccacaacgcttctcaacggcagcgatatttgttcctca
cggtcagctcccacttcgaccaccagcacaaattccggagttcctacatcgatttcgtcg
gcggcatcgacatcttgcactgccactgcagtacccatcaccttcgaagcgctggttagc
acgtcctatggtgagacagttaagctattgggcaacacgactaccctcggtagctggaac
accgccaacgctgtgacgctaagcgcgtcaaagtacaccagcagcaacccgctgtggtac
gtatccttcgaccttgcgccgggaaatgtcatactatacaaatttatcaaggtaaacagt
tcagggactgtttcttgggagagtgatcccaatcacaaatatacggtgccttgcgcagcc
gccacggtatcttcaacttggaggaaatga

DBGET integrated database retrieval system