KEGG   Naumovozyma castellii: NCAS_0F04080Help
Entry
NCAS_0F04080      CDS       T02233                                 

Gene name
NCAS0F04080
Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0F04080 (NCAS0F04080)
   00051 Fructose and mannose metabolism
    NCAS_0F04080 (NCAS0F04080)
   00052 Galactose metabolism
    NCAS_0F04080 (NCAS0F04080)
   00500 Starch and sucrose metabolism
    NCAS_0F04080 (NCAS0F04080)
   00520 Amino sugar and nucleotide sugar metabolism
    NCAS_0F04080 (NCAS0F04080)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NCAS_0F04080 (NCAS0F04080)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NCAS_0F04080 (NCAS0F04080)
Membrane trafficking [BR:ncs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NCAS_0F04080 (NCAS0F04080)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6:814117..815577
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMADVPQELLNKLQELEQMFTVSAETSRAVVKHFISELDKGLSKQG
GNIPMIPGWVVEYPTGKESGDYLAIDLGGTNLRVVLIKLGGDRTFDTTQSKYKIPDGMRT
TQNPDELFEFIADSLAAFLEEIYPEGVTKNLPLGFTFSYPASQDKINEGILQRWTKGFDI
PGVEGHDVVQMLQKQLDKKKIPIDLVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDKVSDIPKLEGKLADDIPGSSVMAINCEYGSFDNEHSVLPRTKYDVQIDEESPRPGQQA
FEKMTSGYYLGELLRLAVLDLQSQGLILKGQDMTKLQVPYVMDTSYPARIEEDPFENLED
TDSLLQKEFNIKTTVQERKLIRRLCEVIGIRAAELAVCGIAAICQKRGYETGHIAADGSV
YKMYPGFPEKAAEGLRKIYGWKPAPMDQYPLQIVASEDGSGTGAAIIAALTEKRLAAGKS
VGIIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaagaaaccacctgccagaaagggatccatggctgatgtccca
caagaattgttaaacaaattgcaagaactagaacaaatgttcactgtctctgctgaaact
tccagagccgttgttaagcatttcatctccgaattagacaagggtttatccaagcaaggg
ggtaacattccaatgattccaggttgggtcgttgaatatccaactggtaaggaatccggt
gattatttggctatcgatttgggtggaaccaacttgagagttgtcttgatcaagttgggt
ggtgaccgtacatttgacactactcaatccaaatataagattccagatggaatgagaact
actcaaaaccctgatgaattgttcgaattcattgctgattccttagctgccttcttagaa
gaaatttacccagaaggtgtcactaagaacttaccattaggtttcactttctcctaccca
gcatctcaagataagattaatgaaggtatcttacaaagatggaccaagggtttcgatatc
ccaggtgttgagggtcatgatgttgttcaaatgttacaaaagcaattagacaagaagaag
atcccaattgatttggtcgctttaattaacgataccaccggtactttggttgcctctttg
tatactgatggtgaaaccaagatgggtgttatcttcggtactggtgtcaacggtgcttac
tacgataaggtttctgacattccaaagttggaaggtaagttggctgatgatattccaggt
tcttctgttatggccattaattgtgaatatggttctttcgacaatgaacattctgtttta
ccaagaaccaaatacgacgtccaaattgatgaagaatctccaagaccaggccaacaagct
ttcgaaaagatgacttccggttattacttgggtgaacttttacgtttagctgtcctcgat
ttacaaagccaaggtttgatcctaaagggtcaagatatgaccaaattgcaagttccatac
gtcatggatacctcctacccagccagaattgaagaagatccatttgaaaacttggaagac
actgactctttgttacaaaaggaattcaatatcaagactactgttcaagaacgtaaattg
attagaagactatgtgaagtcatcggtatcagagctgctgaattagctgtctgtggtatt
gctgccatctgtcaaaagagaggttacgaaactggccatattgctgctgatggttctgtt
tacaagatgtacccaggtttcccagaaaaggctgctgaaggtttgagaaagatctacggt
tggaaaccagctccaatggaccaatacccattacaaattgtcgcctctgaagatggttct
ggtactggtgccgctatcattgctgcattgactgaaaaaagattggctgctggtaagtct
gttggtatcattggtgcttaa

DBGET integrated database retrieval system