KEGG   Naumovozyma castellii: NCAS_0H00490Help
Entry
NCAS_0H00490      CDS       T02233                                 

Gene name
NCAS0H00490
Definition
(RefSeq) hypothetical protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    NCAS_0H00490 (NCAS0H00490)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    NCAS_0H00490 (NCAS0H00490)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NCAS_0H00490 (NCAS0H00490)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8:86965..87429
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVLRGTVGISGIVTFEQPTEKDDTIITYEITGNDPNALRGFHIHEFGDVSNGCVS
AGPHFNPFAQTHGAPTDKVRHVGDMGNIPTDAQGVAKGTIKDSLIKLLGPTSVIGRSVVV
HAGQDDLGKGGNEESFKTGNAGGRVACGVIGVTH
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagcagtagcagtactaagaggaacagtcggcatttcaggcatagtcaccttc
gaacaaccaacagagaaggacgacaccatcataacctacgaaatcacagggaacgaccca
aacgccctccgtgggttccatattcatgaattcggtgatgtctccaatggctgtgtctct
gcaggtcctcatttcaacccattcgctcagactcatggggcccccactgacaaggtcaga
catgtaggggacatgggtaatattcctaccgatgctcagggggtcgctaagggaaccatc
aaggattctttaattaaattgttgggcccaacttccgtcattggaagatccgtcgtggtt
catgccgggcaagatgatttggggaaaggtgggaatgaagaatctttcaagacggggaac
gcaggcgggagagtcgcctgtggtgtcattggtgttactcattga

DBGET integrated database retrieval system