KEGG   Nocardioides dokdonensis: I601_0325Help
Entry
I601_0325         CDS       T04431                                 

Gene name
geoB
Definition
(GenBank) Geranial dehydrogenase
Organism
ndk  Nocardioides dokdonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Dpy-30
Motif
Other DBs
NCBI-ProteinID: ANH36778
UniProt: A0A1A9GET0
LinkDB All DBs
Position
complement(344057..345550)
Genome map
AA seq 497 aa AA seqDB search
MTQTQGQRPIATDALDRDTFYIDGAWAAPATGAVIEVVSPHTEQVVARVPDGSPADIDAA
VAAARRAFDEGPWPRTSPEERIEVLQRFSHLYAARLGDMAELITIEMGSPTSFSNLAQSP
APWMQVEAFIAIARDFPWEAARSGVLGSDVVVRHEPVGVVAAIPPWNVPQFTLISKVVPA
LLAGCTVVAKPAPESPLDAYLLAELLDEAGVPPGVVNIVAGGREVGAHLVAHPGIDKVAF
TGSTAAGRLIGAVCGEQLKRCSLELGGKSAAIVLADADLGPTMEGLRFTALMNSGQACVA
QTRILAPRSRYDEVVDALAETVGSMPVGDPADPATEVGPMVARRQQERVSSYIELGQQEG
ARLVVGGTGMPDGLERGWYVRPTVFADVDNRMRIAQEEIFGPVLSVIAYDDVDDAVRIAN
DSDYGLAGTVWTTDQEAGLDVARRVRTGTYGINTYTMDFAAPFGGFKASGLGREFGPEGL
AQYTETKSIYVPPAPAV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacccagggccagcgcccgatcgcgaccgacgcgctcgaccgcgacaccttc
tacatcgacggagcctgggcggcgcccgccaccggtgcggtcatcgaggtggtgtccccg
cacaccgagcaggtcgtcgcccgggtgccagacggcagccccgccgacatcgacgccgcg
gtcgccgcggcccgccgggccttcgacgaggggccctggccgcggacctcgcccgaggag
cgcatcgaggtcctgcaacgcttctcgcacctgtacgcggcacggctgggcgacatggcc
gagctcatcacgatcgagatgggttcgcccacgtccttctccaacctggcccagtcgccg
gcgccctggatgcaggtcgaggccttcatcgcgatcgctcgcgacttcccgtgggaggcg
gcccggtcgggcgtgctcggctccgacgtcgtggtgcgccacgagccggtcggcgtggtc
gcggccatcccgccgtggaacgtcccccagttcaccctgatctccaaggtcgtgcccgcg
ctcctcgccggctgcacggtggtcgccaagcccgccccggagagcccgctcgacgcctac
ctgctcgccgagctgctcgacgaggccggcgtaccgcccggtgtggtcaacatcgtggcc
ggtgggcgcgaggtcggtgcgcacctggtcgcccaccccggcatcgacaaggtcgccttc
accggctcgaccgcggcaggtcggctgatcggcgccgtgtgcggtgagcagctcaagcgc
tgctcgctggagctgggcgggaagtcggcggccatcgtgctcgccgacgccgacctgggc
cccaccatggaggggctgcggttcacggcgttgatgaactcggggcaggcctgtgtggcc
cagacccgcatcctggcgccccggagccggtacgacgaggtcgtcgacgcgctcgccgag
accgtgggctcgatgccggtcggcgacccggccgacccggcgaccgaggtggggccgatg
gtcgcgcgtcggcagcaggagcgcgtgtcgtcgtacatcgagctcggccagcaggagggt
gcccgcctggtggtgggcggcaccgggatgcccgacgggctggagcgcggctggtacgtg
cgtcccacggtgttcgccgatgtcgacaaccggatgcggatcgcccaggaggagatcttc
ggcccggtcctgtcggtgatcgcctacgacgacgtcgacgacgcggtgcggatcgccaac
gactccgactacggcctggcgggcacggtgtggacgaccgaccaggaggccgggctggac
gtggcccggcgggtgcgtaccggcacctacgggatcaacacctacacgatggacttcgcc
gccccgttcgggggtttcaaggcctccggcctcgggcgcgagttcgggcccgaggggctg
gcgcagtacaccgagacgaagtccatctacgtcccgcccgccccggcggtctag

DBGET integrated database retrieval system