KEGG   Nocardioides dokdonensis: I601_2209Help
Entry
I601_2209         CDS       T04431                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ndk  Nocardioides dokdonensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ndk00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    I601_2209
Enzymes [BR:ndk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     I601_2209
DNA repair and recombination proteins [BR:ndk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     I601_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2299713..2300621
Genome map
AA seq 302 aa AA seqDB search
MAGEEVHVDVEGRTLRLTNLDKVLYPATGTTKGEVLHYYAQIAPTLLPHLADRAVTRIRW
PHGVGGSSFFEKNAPSGTPSWVRTVSVPTTGSRGESRHGDRLVFPVVDDLATLTWLANLA
ALELHVHQWRVGRNGRPRNPDRIVIDLDPGDPAGLHECCQVALLVRDRLAGRGLVARPVT
SGSKGLHLYATLPQRLAADAATELAKEVADELSAARPRHVTATMTKARRGGKVFLDWSQN
AASKTTITPYSLRGRERPYVAAPVSWAEVEAGAEDPLGLEQLRFEEVLERVADLGDLFAK
PT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggaggaggtgcacgtcgacgtcgagggccgcaccctgcgcctgaccaacctc
gacaaggtgctctacccggccaccggcaccacgaagggcgaggtgctgcactactacgcc
cagatcgccccgacgctgctgccgcacctcgccgaccgggccgtgacccgcatccgctgg
ccgcacggggtcggcgggagcagcttcttcgagaagaacgccccgtctggcaccccgtcg
tgggtgcgcaccgtctcggtgccgaccaccggcagccggggggagtcccggcacggcgac
cggctggtcttcccggtcgtcgacgacctcgcgaccctgacctggttggccaacctcgcg
gccctcgagctgcacgtgcaccagtggcgggtcgggcgcaacgggcggccccgcaacccc
gaccggatcgtcatcgacctcgaccccggcgaccccgccgggctgcacgagtgctgccag
gtggcgctgctggtgcgcgaccggctggccgggcgcggcctggtcgcccgcccggtcacc
agcggcagcaaggggctgcacctctacgccaccctgccccagcgcctcgcggccgacgcc
gcgaccgagctggccaaggaggtcgccgacgagctctcggccgcccgtccccgccacgtc
accgccaccatgaccaaggcgcgccgcggcggcaaggtgttcctcgactggtcgcagaac
gccgcgtcgaagaccaccatcacgccctactcgctgcgcgggcgcgagcggccgtacgtc
gccgcgccggtgtcgtgggccgaggtcgaggccggcgcggaggaccccctggggctggag
cagctgcgcttcgaggaggtcctcgagcgggtcgcggacctcggcgacctgttcgccaag
cccacctga

DBGET integrated database retrieval system