KEGG   Nonlabens dokdonensis: DDD_3319Help
Entry
DDD_3319          CDS       T02441                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ndo  Nonlabens dokdonensis
Brite
Enzymes [BR:ndo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DDD_3319 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD DUF3211 FAM176 FSAP_sig_propep Big_3_5
Motif
Other DBs
NCBI-ProteinID: AGC78446
UniProt: L7WET3
LinkDB All DBs
Position
3566742..3567386
Genome map
AA seq 214 aa AA seqDB search
MKKLIIGIMALTLSISVSSCKEAKEEVETEAHDHEHTHDGETHSHEHDGDDHHSDDMDKA
GTKLMVGKEVMVPMSAKSGSNVSGTITFTQNEKEVAMNVDLKGLTPGMHAIHIHQNGDCS
SDDGKSAGGHWDPTSEAHGKWGDEMHHSGDIGNLEVGEDGMATLDFSTDKWCIGCDDETR
NIVGKGVIVHASADDFESQPSGAAGAREACGVIE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaataattggaataatggcacttaccttatcaataagtgtatcttcttgc
aaagaagcaaaagaagaagtagaaacagaagcacacgatcatgaacatactcatgatgga
gaaactcacagtcatgagcacgatggcgacgatcatcatagtgatgatatggataaagca
ggtactaaattaatggtaggaaaagaagtaatggttcctatgtctgcaaaaagtggtagt
aatgtaagtggtactattaccttcactcagaatgaaaaagaagtagccatgaatgtggat
ttgaaaggattgactcctggaatgcatgcaattcacatacaccaaaatggtgattgtagc
tcagacgacggaaaaagcgctggtggacactgggatcctacaagtgaagctcatggaaaa
tggggtgacgagatgcatcactcaggtgatataggtaacctagaagtaggagaagatgga
atggctacattagattttagcactgataaatggtgtataggatgcgatgatgaaacacgt
aatatcgtaggtaaaggtgtaatcgttcacgcaagtgctgacgattttgaatctcaacct
agtggtgctgcaggagctagagaagcctgtggagtaattgaataa

DBGET integrated database retrieval system