KEGG   Candidatus Nitrososphaera evergladensis: NTE_02196Help
Entry
NTE_02196         CDS       T03224                                 

Definition
(GenBank) ATP-dependent DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nev  Candidatus Nitrososphaera evergladensis
Pathway
nev03030  DNA replication
nev03410  Base excision repair
nev03420  Nucleotide excision repair
nev03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nev00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NTE_02196
   03410 Base excision repair
    NTE_02196
   03420 Nucleotide excision repair
    NTE_02196
   03430 Mismatch repair
    NTE_02196
Enzymes [BR:nev01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NTE_02196
    6.5.1.6  DNA ligase (ATP or NAD+)
     NTE_02196
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NTE_02196
DNA replication proteins [BR:nev03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NTE_02196
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NTE_02196
DNA repair and recombination proteins [BR:nev03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NTE_02196
   NER (nucleotide excision repair)
    Other NER factors
     NTE_02196
   MMR (mismatch exicision repair)
    Other MMR factors
     NTE_02196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIF84250
UniProt: A0A075MSW0
LinkDB All DBs
Position
1799258..1801078
Genome map
AA seq 606 aa AA seqDB search
MDFQPLVETFGKMEETSSRLALTDHLVALLKETPADLIDKVTYLIQGKLYPDYEGIEMGL
AERMALRAIASSSSRSMSEVEAIYRKKGDIGDAAREAMESKGQSTLFSEQMTVERVYCTF
DKIAKTTGPGSQETKLRLVASLLNDSTPDEGRYIMKFVMGALRLGIADYTVLDALAIAFT
GDKANRKVLENAYNVSSDLGTVAKLLATKGLAAVKAVQITLFKPIRPMLAERVSTAEEAM
ERMDSRAAIEYKLDGERVQIHKGRDRVELFSRRLEKITDHYPDVSKAAMSLACKEAIMEG
EVVAVNLQTGEYLPFQQLMHRRRKHGIEEAMENYPVVINLFDILYLDGKSRTELPYEERR
KLLEKTVKGAKDNGIMLKIVPQVVATEPAEIDRFMASAIENGCEGVMVKMPSSTYRAGAR
EYLWVKLKREYRTELADTLDLVIVGALHGRGRRVGKYGALLLAAYDPKEDIFRSVTKVGT
GFTDIHLDQFYRELEKHVIHQKHARVDTGMSMEVWFEPVIVIEVIASEITLSPSHMAAMD
AIKEGYGLALRFPKFTGKIRDDKEPEGATTTDEIVTMYRRQLKIHSEAAKSKEQEKKKKE
SEEGEE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
gtggatttccagcctctggtagagacgtttggcaagatggaggagacgtccagcaggctg
gcccttaccgatcacttggttgcactgttgaaagagacgccggcggacctgatagacaag
gtgacgtacctcatacagggcaaattatatccagactatgaaggcatagagatgggcctt
gcagagcgcatggcgctccgggcaatagcaagctcgtcaagcaggagcatgtccgaagtt
gaagcgatttaccgtaagaaaggcgacattggagacgccgcacgcgaggcgatggagtca
aagggccagtcgacgctgttttcagagcagatgacggtagagcgcgtctattgcactttt
gataagattgccaagacgactggccccgggtcgcaggaaacgaaactgcgccttgtcgca
agcctgctcaacgactctacgccggacgaggggcgctacatcatgaagtttgtcatggga
gcgctcaggcttggcatagcagattacactgtgcttgacgcgcttgccattgcgtttacc
ggcgacaaggcaaacagaaaagttctggagaacgcctacaacgtttcaagcgaccttggc
acggttgcaaagctgcttgcgacaaaaggtcttgccgcagtcaaggcggtgcagataacc
ctgttcaagcccatcaggccgatgcttgccgagcgcgtttccaccgctgaagaggcgatg
gagcgcatggacagccgcgcggcaatagaatacaagctggacggcgagcgggtccagatc
cacaaaggcagagaccgcgtcgagcttttttcacgcaggctggaaaagataaccgaccac
tacccagacgtcagcaaggcggcaatgtcgcttgcctgcaaggaggcaataatggaggga
gaggtcgtggcggtaaacctgcagacgggggaatacctgccgtttcagcagctgatgcac
cgaaggcgcaagcacggaatcgaagaggctatggaaaactaccctgtggtcatcaacctt
tttgacatcctctaccttgatggcaagagcaggactgaactgccgtacgaagaacgccgc
aagctcttggaaaagacagtcaaaggcgccaaggacaacgggataatgctgaaaatagtg
ccgcaggtcgttgctacagagccggcagaaatagaccggtttatggcctctgcgatagag
aacggctgcgaaggcgtcatggtaaagatgccgtcaagcacgtaccgcgcaggagcccgc
gagtacctgtgggtgaaactaaagcgcgaatacagaacagaacttgcagacacgcttgac
cttgtcatcgtaggcgcgctgcacggtcggggaaggcgcgtgggcaagtacggcgccctg
cttttggcggcgtacgacccaaaggaggatattttccgtagcgtgacaaaggtggggacc
ggatttactgacatacaccttgaccagttttaccgcgagctggaaaagcacgtgatacac
caaaagcacgcccgagtggacacgggcatgagcatggaagtttggtttgagcctgtgatt
gttattgaagtcattgcgtcggaaattaccctgagcccgtcgcacatggcggcgatggat
gccataaaggaaggctatggcctcgcactgcggttccccaagttcacagggaaaatccgc
gacgacaaagagcccgagggcgcaaccaccactgacgagattgtgaccatgtaccggcgc
cagctaaagatccactcggaagctgccaagtcaaaagagcaagagaaaaagaaaaaggaa
agtgaagaaggagaagaatga

DBGET integrated database retrieval system