KEGG   Nocardia farcinica IFM 10152: NFA_25590Help
Entry
NFA_25590         CDS       T00207                                 

Definition
(GenBank) hypothetical protein
Organism
nfa  Nocardia farcinica IFM 10152
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NIH_Japan: 
UniProt: 
LinkDB All DBs
Position
complement(2727596..2728597)
Genome map
AA seq 333 aa AA seqDB search
MSGPTLEVEVDGRVLAISNPDKVYFTKRGETKADLVRYYQAVAEPLLGVIRDRPLLLERH
PDGASGKSWFQKRVPKSAPDWLHTVEVTTPNGTTSDALVAHDLAHILWAVNQGCLGFHVW
PNRVRDLTVADELRIDLDPSPGIGYPDLVRAAKLTRGLFDELGIASAVKTSGSRGLHIYV
ALEPRWDGYQVRAAAVALARELERRHPDLITAHWWKEERGQRVFVDYNQNAPHKTVFGAW
CVRPKVGAQVSTPISWDDLDSVVPDDLTIATVPARLAERGDPWADRAPQSIEPLLAMSER
DMAAGLMDAPWPPQYPKMPNEPPRVQPSRAKKQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcccaccctggaggtcgaggtcgacggccgggtgctggccatcagcaacccg
gacaaggtgtatttcaccaagcgcggggagaccaaggcggatctggtccgctactaccag
gcggtggccgagccgctgctcggggtgatccgtgatcggccgctgctgctggaacggcat
cccgacggcgcatcgggcaagtcgtggttccagaagcgggtgcccaagtcggccccggac
tggctgcacacggtcgaggtgaccacccccaacggcaccaccagcgacgcgctcgtcgcg
cacgacctcgcgcacatcctctgggcggtgaaccagggctgcctgggctttcacgtctgg
ccgaaccgggtgcgggacctcaccgtcgccgacgagctgcgcatcgatctcgatccctcc
cccggcatcggctatccggacctggtgcgggcggcgaaactgaccaggggattgttcgac
gagctgggcatcgcgtcggccgtgaagacctccggctcgcgcggtctgcacatctacgtc
gcgctcgagccgcgctgggacgggtaccaggtgcgcgcggcggcggtcgcgctggccagg
gagctggagcggcggcatccggacctgatcaccgcgcactggtggaaggaggagcgcgga
cagcgggtcttcgtcgactacaaccagaacgccccgcacaagaccgtgttcggggcctgg
tgtgtgcggcccaaggtcggcgcgcaggtgtccacgccgatctcctgggacgacctggac
agcgtggtgcccgacgatctcaccatcgcgaccgtgcccgcgcggctggccgagcgcggc
gatccgtgggcggaccgggcgccgcaatcgatcgagccgctgctggcgatgtcggaacgg
gacatggccgccgggctgatggacgcgccgtggccgccgcagtacccgaagatgcccaac
gagccgccgcgggtgcagcccagccgggccaagaagcagtag

DBGET integrated database retrieval system