KEGG   Nocardia farcinica IFM 10152: NFA_27070Help
Entry
NFA_27070         CDS       T00207                                 

Gene name
katB
Definition
(GenBank) putative catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NFA_27070 (katB)
  Amino acid metabolism
   00380 Tryptophan metabolism
    NFA_27070 (katB)
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     NFA_27070 (katB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NIH_Japan: 
UniProt: 
LinkDB All DBs
Position
2871671..2873830
Genome map
AA seq 719 aa AA seqDB search
MTGHTPDTPDNAADADHAAGGADRKQRQLDAHRVDREQGHLTTQQGVRVRHTDDALSAGA
RGPTLLDDFHAREKITHFDHERIPERVVHARGAGAYGYFQPYDDRLAEYTVAKFLTDPAE
RTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTSQGNYDLVGNNFPVFFIQDGIKFPDFV
HAVKPEPHNEIPQAASAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFR
FLDAAGTPTFVKFHWTPKLGVHSLVWDECQQIAGRDPDYNRRDLWDCIEAGHYPEWELGV
QLIPVEKEFDFDFDLLDATKLVPEEQVPVLPVGRMVLDRNPDNFFAETEQVAFHTANLVP
GIDFTDDPLLQLRNFSYLDTQLIRLGGPNFAQIPINRPVADVRNHQQDGYGQHAIPRGQA
SYTVNSIGGGCPVVGGDGSYEHYPRQVDGRAQRRRAESFREYYRQPRMFWRSMSAPEAEH
IVEAFAFELGKVQRVEIRERTLGQLVRIDPDLAVRVAGRLGLPAPPPDPEAGTDAFVSPA
LSQAHTAKDSIATRQVAVLAADGVDAAGVRALRSALTERGAIVEVIASHGGMVHADGGDG
DTLPVDRTLMTVASVLYDGVVVAGGQTGVETLTRNGEAVHFVLEAFKHAKPVAAFGAGVS
LLRIAGILDAARAHDADPATGVITTEARGDGLDEEFVTDLARALANHRTWQRATSAIPA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactgggcacacccccgacacccccgacaatgccgccgacgccgaccacgccgccggc
ggagcggatcgcaagcagcgtcagctcgacgcccaccgggtcgaccgggagcagggccac
ctcaccacccagcagggcgtgcgagtgcgccacaccgacgacgcgctctcggccggagcc
cgcggccccacgctgctcgacgacttccatgccagggagaagatcacccacttcgatcac
gagcgcattcccgaacgcgtggtgcacgcgcgcggcgccggtgcctacggctacttccag
ccctacgacgaccggctggccgaatacaccgtcgcgaagttcctgaccgatcccgccgaa
cgcaccccggtgttcgtgcgcttctccaccgtcgccggttcccgtggttcggccgacacc
gtgcgcgacgtgcgcggtttcgcgaccaagttctacacctcgcagggcaactacgacctg
gtcggcaacaacttcccggtgttcttcatccaggacggcatcaagttccccgacttcgtg
cacgcggtgaaacccgagccgcacaacgagataccgcaggccgcctcggcgcacgacacc
ctgtgggacttcgtgtcgctgcagccggagaccctgcacgcgatcatgtggctgatgtcg
gaccgggcgctgccgcgcagctaccggatgatgcagggcttcggcgtgcacaccttccgg
ttcctcgacgccgcgggcacgccgaccttcgtgaagttccactggacgcccaagctcggg
gtgcactcgctggtgtgggacgaatgccagcagatcgccgggcgcgaccccgactacaac
cgccgcgatctgtgggactgcatcgaggccgggcactatccggagtgggagctgggcgtg
cagctcatcccggtggagaaggagttcgacttcgacttcgacctgctcgacgccaccaag
ctggtccccgaggaacaggtgcccgtgctgccggtgggccggatggtgctcgaccgcaac
ccggacaacttcttcgccgagaccgagcaggtcgccttccacaccgccaacctggtaccg
ggcatcgacttcaccgacgacccgctgctgcaactgcgcaacttctcctatctggacacc
cagctgatccggctcggcggtcccaacttcgcccagatcccgatcaaccgcccggtcgcc
gatgtgcgcaaccaccagcaggacggctacggccagcacgccatcccgcgcgggcaggcg
agctacaccgtcaacagcatcggcggcggctgccccgtcgtgggcggcgacggctcctac
gagcactacccgcggcaggtggacggccgggcgcagcgccggcgcgccgagagcttccgg
gagtactaccggcagccgcggatgttctggcgcagcatgtccgcaccggaggccgaacac
atcgtggaggccttcgccttcgaactcggcaaggtgcagcgggtggagatccgcgagcgc
acgctcggccagctggtgcgcatcgaccccgacctggccgtgcgggtggcgggccggctc
ggtctgcccgcgccgccgccggaccccgaggccggcaccgatgccttcgtctccccggcc
ctctcgcaagcccacaccgccaaggacagcatcgccacccggcaggtcgcggtgctggcc
gccgacggagtggacgcggcgggggtgcgggcgctgcgctcggcgctcaccgaacgcggc
gcgatcgtggaggtgatcgcctcgcacggcggcatggtgcacgccgacggcggcgacggc
gacaccctgccggtcgatcgcacactgatgacggtggcctcggtgctctacgacggcgtc
gtggtcgccggcgggcagaccggggtggagacgctgacacgcaacggcgaggcggtgcat
ttcgtcctcgaggcgttcaagcacgccaaaccggtcgcggcgttcggtgcgggtgtctcg
ctgttgcggatcgcgggcatcctcgacgcggcgcgcgcacacgacgccgacccggctacc
ggtgtgatcaccaccgaggcgcgcggtgacggcctcgacgaggagttcgtgaccgatctg
gcgcgggcactggcgaaccatcggacgtggcagcgggcgacctcggcgattccggcataa

DBGET integrated database retrieval system