KEGG   Aspergillus fischeri: NFIA_049950Help
Entry
NFIA_049950       CDS       T01070                                 

Definition
(RefSeq) glutathione-s-transferase theta, gst
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
nfi  Aspergillus fischeri
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NFIA_049950
Enzymes [BR:nfi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NFIA_049950
Transporters [BR:nfi02000]
 Other Transporters
  Pores ion channels [TC:1]
   NFIA_049950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 223 aa AA seqDB search
MLPIVLYSHPYGPNPWKVAIILEELGLPYETRFVNFTDVKKEPYIKLNPNGRLPAIEDPN
EGITLFESGAIVEYLVEHYDPENKLHYTETAAKYQTKAWLHFQASGQGPYYGQASWFARF
HPERIPSAVERYGNEIRRVTGVLESILKTREWLVGDKCTYADLCFLPWQRWASKYATNPD
TLDDDFPHVAAWYKKLTSRPAVKKVFKDQDQAIEKAEREKTGI
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctattgtcctctattcacacccctacggccctaatccttggaaagtggccatc
atccttgaggagttgggtcttccctacgaaacccgctttgtcaatttcaccgatgtcaag
aaagagccttatatcaagttgaatccaaatggtcgcctgcctgcaattgaggatccgaac
gagggtattactctttttgagtctggtgctattgtggaatatctagtcgaacactatgac
cctgaaaacaagctccactatacagaaaccgccgcaaaatatcaaaccaaggcatggctg
catttccaggcatctggccagggcccttattatggccaggccagttggttcgcacgattt
caccctgaacgcattccttctgccgtcgagcgatatggcaacgagattcgccgtgtgacc
ggggttcttgagtctatactgaagacccgcgaatggttggttggtgacaagtgcacgtat
gctgacctttgcttcttgccatggcaaagatgggcttcgaaatacgcgacaaatcctgat
accctcgacgacgacttccctcatgtcgccgcgtggtacaagaaattgacatcgcgcccg
gctgtaaagaaggttttcaaagaccaggaccaggcaattgagaaggctgagagggaaaag
accggtatctaa

DBGET integrated database retrieval system