KEGG   Aspergillus fischeri: NFIA_051950Help
Entry
NFIA_051950       CDS       T01070                                 

Definition
(RefSeq) SET domain protein
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
nfi  Aspergillus fischeri
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NFIA_051950
Enzymes [BR:nfi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NFIA_051950
Chromosome [BR:nfi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     NFIA_051950
   HMT complexes
    COMPASS/SET1 complex
     NFIA_051950
    COMPASS/SET1 complex (yeast)
     NFIA_051950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 1241 aa AA seqDB search
MSRTSAGFADFFPTAPSVLQQKRVRAPRDRSRSKDRPEDQLQVQDGNGQLACSSGASAAN
VSTNGSPPSVSVSETGTGVEKPGCKLVEETNTDITGTDTSILSASLAQCRATQVNEARFD
NLTPVTNAESSPPRKLSPHQSKSVSVAEYESNKFATDELKLAATPLHTPPTPRSQTSRSG
VIKGCKLVYDPDLEKRSSKEKRRKPQYVDFVVNEQDGCSPDPRLSILNYTRGAGCKQKTK
YRPAPYRLKQWPYDTATTIGPGPPVQIVVTGFDPLTPVAPINALFSSFGEISEINNRTDP
ITGRFLGVCSVKYKDSTSFRGAGPIPAATAARRAYVECKKEQRIGTRRIRVELDRDGAVS
DRIVARAIESQRMGHKKNTVGEEAKIEPQAKKNEPPPTAPKGPSRSSTRPAAAVPEGPRA
SFLKPAMPSLIEETPILGQIKRDPYIFIAHCYVPVLSTTIPHLKKRLKLFDWKDIRCDKT
GYYIIFENSRRGEEETERCFKVCHMKPLFTYIMNMESQPYGNPNYERSPSPERLQAERRE
RAERERLKKEADLDLEEEKKQRAIDLDPCREVLALIVRDLKDKLLEDVKSRIAAPTLYDY
LDPDRHAARRRALGIPDPEGIRRHTFQLDVDIFGSNNPQSSLPGGRSFSPYGLNILALPR
IRKARRLNRAHAAFLDERRKQPVRRKEVRPLYHRLQQLHDVDDSDEDQRTPFSRDIDEQD
SRPPSRMSSRSSISDDGEESEPLDGLASQDKRHEARLLGLEYGDSGTTLNETVDGYSRHD
SPGLSSTRKRKRLAEGIEVRKRPKEESERSELNRSVETENTLFYEESQHSEAAELGAVKP
ENLAGIGGKFLGRLEDRSIKEDGEKENVERLQIKSAIQGADLDVQPPLPDESTIAKSHED
PITEIEWGVSNDEPRPTVDDDETIILDLDGWQNLVKDEEDLCFLRHVLDGQSRSKVGNLS
AWAWRQKEIKALNRPGESGPVHQETRIPDYYVCNPTGAARTEGRKRILESEKSKYLPHRI
KVQKAREEREANAKSDPHASAAEAARISAAKTISKSTSRSTRVNNRRLVADINAQKQALP
MQGGDGDVLRFNQLKKRKKPVRFARSAIHNWGLYAEENISANDMIIEYVGEKVRQQVADM
RERQYLKSGIGSSYLFRIDENTVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIY
ALRDIGRDEELTYDYKFEREWDSDDRIPCLCGSTGCKGFLN
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcacatcggcaggctttgcggacttctttcccactgccccgtcggtccttcaa
caaaaaagagtcagagcgccacgagatcgatctcgctccaaggatcggcccgaggatcaa
cttcaagtccaggatggcaatggacaattggcctgctcttctggagcaagcgcagccaac
gtttctacgaatggcagcccacctagcgtatcagtatcggaaaccggtacgggtgtagag
aaacccggatgcaaactcgttgaagaaacgaacacggacataacgggtacggatacatct
attttaagtgcatcgcttgctcagtgtcgtgcaacgcaggtgaacgaggcacggttcgat
aatctcaccccggtcaccaacgcagagtcgtctccgcctcgcaagttgagtcctcatcaa
tctaagtccgtttccgtggccgaatacgaatcgaacaagtttgcaaccgacgaattgaaa
cttgctgctacacccctacatacaccgccgacgccacggtcgcaaacatcgcgcagtggt
gtaatcaagggttgcaagttggtttacgaccccgatctcgagaaaagatcatcgaaggaa
aagagaagaaagccacagtatgtggactttgtggtgaatgaacaagacggctgttcacca
gacccgcgtctgagtattctgaattacactcgaggtgctggctgtaagcagaagaccaaa
taccggccggctccttatagactgaaacagtggccctatgatactgctactactatcggt
cccggaccccccgtccaaatagtggtcactggcttcgatcccctgaccccagtggctccg
ataaacgcgcttttttcaagcttcggtgagatttcagagataaataatcgcacagacccg
attacaggtcgatttcttggagtatgttcagtcaagtacaaagacagcacctcttttcga
ggtgccgggccaataccagcggcgaccgcggccaggcgagcctacgttgaatgcaagaag
gagcaacggattgggacacgaaggatccgggttgaactagatcgagatggtgctgtctca
gacagaattgtcgcaagggccatcgagtctcaacgaatgggacataagaagaacacagtc
ggagaagaggcaaaaattgagcctcaagcaaaaaagaatgaaccaccgccgacagctccc
aaaggcccttcaaggtcttccacgcgtccggcagccgctgtaccagaaggtccaagagcg
agctttctcaagcccgccatgccctctctgatagaggaaacacccatattagggcaaatc
aagcgggatccatatatcttcatcgcgcactgctacgttcctgttttgagcacaacgatc
ccgcatctgaagaaaagactcaaattattcgactggaaagacattcgatgcgataaaact
gggtactatatcatcttcgagaattctaggcgcggtgaggaggaaaccgagcgttgtttc
aaagtatgccatatgaagcctctttttacttacatcatgaatatggaaagccagccctat
ggcaatcccaactatgagcgaagtccgagcccagaacgactccaagcagagcgacgggaa
cgggcagagagagaaaggctgaaaaaagaggcggatttggatctcgaggaagaaaagaaa
cagcgagcgattgatttggacccatgcagagaagtcctagctctcatcgtccgcgatttg
aaagataagcttcttgaggatgtgaaatcacgcatcgccgccccaacattgtatgactat
ctcgaccctgacagacatgcggcaaggaggcgagctctggggattcctgatcctgagggg
atcagaagacatacttttcaacttgatgttgatatttttggatccaacaatccccagtct
tccctaccgggcggccgttcgttcagcccgtatggccttaacatacttgcgctcccacgc
atccgaaaagctcgtcgtttgaaccgtgcccatgctgccttcttagatgagaggcgtaag
cagcctgttcggagaaaggaagtacgtcctctctatcacagactgcagcagttgcatgac
gtcgacgactctgatgaggaccaacgtactccattctcaagggatattgatgaacaggat
agtcgaccaccgagtcggatgagttccagatcttcaatttccgatgacggcgaggaatca
gaacccttggatggactagcttcccaagacaaaaggcatgaagcgcggctcctaggcttg
gaatatggggatagcggtaccacccttaacgaaacagtcgacgggtattcccgacatgat
tcgcctggtctctcctctacgcgtaaaaggaaaaggctcgcggaaggaattgaagtgcgt
aaacgacccaaggaggaaagcgagcgatcagagttgaatcgctctgtggagactgaaaat
acgttgttctacgaggagtctcaacactcagaagctgctgaacttggcgctgtgaagcca
gaaaacctcgctggtatcgggggtaaattcctgggtcgattggaagacaggtcaatcaag
gaggacggtgagaaagagaatgtggaacggctgcagatcaagtctgccatacaaggagca
gatctcgacgttcagccgccattacctgacgaatccactattgcaaagagccatgaagac
ccgattacagagatcgaatggggggtgtctaatgatgaacctcgtccgacagttgatgat
gatgaaaccataatcttggatttggacggctggcagaatctcgtcaaggatgaggaggat
ctctgcttccttcgccatgttctggacgggcagtcgagatccaaggttggaaatctatcg
gcatgggcttggagacagaaagagattaaagctctcaaccgtcccggtgaaagtgggccg
gtccaccaagagactaggataccagattactacgtttgcaaccccactggagctgctcgg
accgaaggaagaaagagaattttggagtcggagaagtcgaaatacctgcctcaccgtatc
aaagttcagaaggctcgagaagaacgggaggccaacgcaaagagcgatcctcatgcttct
gctgcagaagccgctaggatctccgcggcgaagacgatatctaaatccacttcgagatcg
acaagggttaataatcgcaggctggttgcagacatcaatgcgcaaaagcaggctctccct
atgcaaggtggagatggtgatgttctccgtttcaaccagttgaagaaacgaaagaagcca
gtgcgctttgctcggtcagcgatccacaattggggtctgtacgcggaagagaacatatca
gcgaatgatatgatcatagagtatgttggtgaaaaggtgcgacagcaggtggcagacatg
agggagaggcagtacttgaagagcgggataggtagcagctaccttttccgaattgacgag
aatactgttatagatgccaccaagagagggggtatcgctcgcttcatcaaccatagctgt
actcctaattgcactgcaaagatcatcaaggttgatggtagcaagagaattgttatatat
gctctcagggacattggaagagatgaagagctgacctacgactacaaattcgaacgggaa
tgggacagtgacgacagaattccctgcctctgcggctcgactggttgcaaagggttcctt
aattaa

DBGET integrated database retrieval system