KEGG   Aspergillus fischeri: NFIA_082630Help
Entry
NFIA_082630       CDS       T01070                                 

Definition
(RefSeq) hexokinase Kxk, putative
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
nfi  Aspergillus fischeri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_082630
   00051 Fructose and mannose metabolism
    NFIA_082630
   00052 Galactose metabolism
    NFIA_082630
   00500 Starch and sucrose metabolism
    NFIA_082630
   00520 Amino sugar and nucleotide sugar metabolism
    NFIA_082630
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NFIA_082630
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NFIA_082630
Membrane trafficking [BR:nfi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NFIA_082630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKDFEEMFTVDRAKLKQVVDHFVKELEKGLSVEG
GNIPMNVTWVMDFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGGFDICQSKYRMPEELK
SGTAEELWEYIADCIQQFIEFHHGEEGLTSLPLGFTFSYPATQEYIDHGVLQRWTKGFDI
DGVEGQDVVPPLEETLKRKGLPIKVAALINDTTGTLIASAYTDPEMKIGCIFGTGVNAAY
MEDVGSVPKLAHMNLPPDMPVAINCEYGAFDNEHVVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALIDLLDSRPGLIFQNQDTSKLRKPYLLDASFLAAIEEDPYENLQET
QELFERELNIKPTLAELEMIRRLAELIGTRAARLSACGVAAICKKKNIESCHVGADGSVF
TKYPHFKARGAQALREILDWAPNEKDKVTIMAAEDGSGVGAALIAALTLKRVKAGNLAGI
RNKDEMQKLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaattggtcccaagcgccccccatcccgcaagggatcgatggccgatgtgcct
cagaatcttctacagcagattaaggatttcgaggagatgtttactgtggacagagccaag
ctcaaacaggtggttgaccacttcgtcaaggagctcgagaagggtctcagtgtggagggt
ggtaacatcccgatgaacgttacctgggttatggacttccccgatggagacgagcaggga
accttccttgccttggatatgggtggcaccaacctccgcgtctgtgagattaccttgaca
gaagagaagggaggcttcgatatctgccagtccaagtaccgcatgccggaagaactgaag
tccggaaccgctgaggagctgtgggaatacatcgccgactgcatacagcaattcattgag
ttccaccacggagaggaaggattgacatcattgcccctgggtttcaccttctcctacccg
gctacacaagagtacattgatcatggtgttcttcagcgctggactaagggcttcgacatt
gatggtgtcgagggacaggatgtcgtccctcccctggaggaaacactgaagagaaaggga
cttcctatcaaggtcgctgctttgatcaacgataccactggaacgctcatcgcctcggcc
tacactgatcccgagatgaagattggatgtatttttggtacaggtgtcaatgcggcctac
atggaggatgttggctccgtccctaagctggcccacatgaacttgcccccagacatgcca
gtggccatcaattgcgagtacggtgctttcgacaacgagcacgttgttcttcccctcaca
aagtacgatcacatcattgaccgcgactctccccgcccgggtcagcaggccttcgagaag
atgacagccggtctctacctgggagagatcttccgtctggccctgattgatctcctggac
agcagaccaggactgattttccagaatcaggacaccagcaagctgcgcaagccgtacttg
ctggacgcttccttcctggctgccatcgaggaggacccctacgagaacttgcaggaaaca
caggagctgttcgagcgcgaattgaacatcaagcccactctggccgagctcgagatgatt
cgtcgtctggccgagctgatcggtacgcgtgcagctcgtctgtcagcttgcggtgtggcg
gctatctgcaaaaagaagaacatcgagagctgccacgttggtgcggacggctccgtcttc
accaagtaccctcacttcaaggctcgtggtgcccaggctctgcgagagatcctggactgg
gccccgaacgagaaggacaaggtcaccattatggcggccgaggatggttccggtgtcggt
gccgcgctgatcgccgccttgactctcaagcgtgtcaaggccggcaacctggctggtatc
cggaacaaagacgaaatgcagaaactgctttaa

DBGET integrated database retrieval system