KEGG   Aspergillus fischeri: NFIA_104560Help
Entry
NFIA_104560       CDS       T01070                                 

Definition
(RefSeq) alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00020  Citrate cycle (TCA cycle)
nfi00310  Lysine degradation
nfi00380  Tryptophan metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
Module
nfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NFIA_104560
  Amino acid metabolism
   00310 Lysine degradation
    NFIA_104560
   00380 Tryptophan metabolism
    NFIA_104560
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NFIA_104560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 4594066
NCBI-ProteinID: XP_001266865
UniProt: A1CWG6
LinkDB All DBs
AA seq 1057 aa AA seqDB search
MLRTTAVKATSSGLLRGPACSACRRSISLTSSARTTASHSSKLGLTTRRPLAIVDRLSNG
RRHYAAATDAGVDPNDNFLSGNTANYIDEMYLAWKKDPSSVHISWQTYFKNMEEGNMPIA
QAFQPPPTLVPTPTGGVPQTMPGEGLGLAAGTDLTNHLKVQLLVRAYQARGHHKAKIDPL
GIRGEAEAFGYNKPKELELDHYGFTERDLDQEFTLGPGILPRFATESRKKMTLREIIATC
ERIYCGSYGVEYIHIPDRKPCDWIRDRFEIPEPYKYSVDDKRRILDRLIWSHSFEAFLAT
KFPNDKRFGLEGCETLVPGMKALIDRSVEHGIKDIVIGMPHRGRLNVLSNVVRKPNESIF
SEFSGSAEPSDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRSI
QHYNNDEKDFNSAMGVLLHGDAAFAGQGVVYETMGFHSLPAYSTGGTIHIIVNNQIGFTT
DPRYSRSTPYCSDIAKSIDAPVFHVNADDVEAVNYVCQIAADWRAEFKRDVVIDIVCYRK
QGHNETDQPSFTQPLMYKRIAEQKAQLDKYVEKLIAEGTFTKEDIDEHKKWVWGMLNDSF
DRSKDYQPTGKEWLTSAWNGFKTPKELATEVLPHLPTAVDASLLSHIADKISGAPEGFTV
HRNLKRILANRKKAVDEGKNIDWATAEALAFGSLVKEGYHVRVSGQDVERGTFSQRHAVL
HDQENEATYTPLKHIGEDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFA
NNAQCIIDQFIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRQFPT
QDKLDRQHQDCNMQIAYMTSPANLFHILRRQIHRQFRKPLMIFFSKSLLRHPVARSDIEE
FTGDSHFRWIIPDPAHGTAIDEPEKIERVILCTGQVYATLVKHREANGIRNTAITRVEQL
HPFPWAQLKENLDSYPNAKDIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAG
RAPSASVATGLKSVHAKEEQDFLQEAFTVHQHRLKGE
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtaccacagccgtcaaggccaccagcagcggtctgctgcgtggtcccgcctgc
tcggcctgcaggcggtccatctcccttacttcctctgccagaactactgccagccatagc
tcgaaacttggcttgaccacgaggagacctctcgccattgttgaccgtttgtccaacggc
aggagacactatgctgctgctactgatgcgggagtggatcccaatgacaacttcctttcc
ggaaacacagccaactacattgacgagatgtacctggcttggaagaaggacccttccagc
gtgcacatctcgtggcagacatattttaagaacatggaagaaggcaacatgcccatcgcc
caagctttccagcctcctccgactcttgtgcctactcccaccggtggcgttccgcagacc
atgcctggcgagggattgggcctcgccgctggcactgacctaacaaatcatcttaaggtc
cagcttttggttcgcgcataccaggctcgtggtcaccacaaggccaagatcgatcccctt
ggcatccgcggcgaagctgaggcattcggctacaacaagcccaaggagcttgaacttgac
cactatgggtttactgagcgcgatctcgaccaggagttcaccctcggccccggtattttg
cctcgcttcgccactgagagccgcaagaagatgactctgcgcgagatcatcgccacctgc
gagaggatctactgtggctcctacggtgtggagtacattcacattcctgaccgcaagccc
tgcgactggatccgtgatcgcttcgaaattcccgagccctacaagtactcggttgacgac
aagcgccgtatccttgaccgtctcatctggagccacagcttcgaggccttcctggccacc
aagttccccaatgacaagcgtttcggtctggagggttgcgagacccttgtgcccggtatg
aaggcgttgattgaccgcagcgtcgagcacggcatcaaggacattgtcattggtatgcct
caccgtggtcgtctcaatgtgctgtccaacgtcgttcgtaagcccaacgagtccatcttc
agtgaattctccggatctgccgagccctcggatgaaggttcgggtgatgtcaagtaccac
ttgggtatgaacttcgaacgtcccacgccctctggtaagcgtgtgcagctctctctggtc
gccaacccctcccatctcgaagccgaggaccccgttgttcttggcaagacccgctctatt
cagcactacaacaatgacgagaaggacttcaacagcgccatgggtgttctgctgcacggt
gatgctgccttcgccggccagggtgtcgtctacgagaccatgggcttccactctctcccc
gcctactcgaccggtggtactatccacatcatcgtgaacaaccagattggtttcactacc
gacccccgttactcgcgttccaccccttactgctcggatattgccaagtccatcgacgcc
cccgtgttccacgtgaacgctgatgatgtcgaggccgtgaactacgtttgtcagattgct
gccgactggcgtgccgagttcaagcgcgatgtcgtcattgacatcgtctgctaccgtaag
cagggtcacaacgaaaccgaccagccctctttcactcagcccttgatgtacaagcgcatc
gccgagcagaaggcccagcttgacaagtatgtcgagaagctgattgccgagggaaccttc
accaaagaggacattgacgagcacaagaagtgggtttggggtatgctcaacgacagcttc
gaccgcagcaaggattaccagcccaccggcaaggaatggctgacctctgcctggaacggc
ttcaagacccctaaggagctggccaccgaggttctacctcatctgcctaccgctgttgat
gcttctttgttgagccacattgccgacaagatcagcggcgcccccgagggcttcaccgtc
caccgcaacctcaagcgtattttggccaaccgcaagaaggccgttgatgagggtaagaac
attgactgggccaccgcggaggcccttgcctttggttctctggtcaaagagggctaccat
gtccgtgtttccggtcaggacgttgagcgtggtaccttctcccagcgtcacgccgttctg
cacgaccaggagaacgaggctacctatacccccttgaagcacattggtgaggatcagggc
agcttcgtcatctccaactcttccctcagcgaattcggagccctcggtttcgaatacggt
tactctctgacctcccctaatgccctggtcatgtgggaggcccagttcggtgacttcgcc
aataacgctcagtgcattatcgaccagtttatcgcttctggagagtccaagtggctgcag
cgctccggtctcgttgtctctctgcctcacggttatgatggccagggccctgagcactct
tcgggtagaatggagcgttggttgcagctttgcaacgaggaacctcgccagttccccact
caggacaagttggaccgtcagcaccaggactgcaatatgcagattgcctacatgacctct
cctgccaaccttttccacatcttgcgtcgccaaatccaccgccagttccgcaagcccctc
atgatcttcttctccaagtccctcctccgccaccctgttgctcgctccgatatcgaggaa
ttcaccggtgactcgcacttccggtggatcatccctgacccggcccacggtaccgccatt
gacgagcccgagaagatcgagcgcgtcattctgtgcactggccaggtctatgctaccttg
gtcaagcaccgcgaggccaatggtatccgcaacactgccatcacccgtgttgagcagctg
caccccttcccttgggctcagctgaaggagaacctggacagctaccctaacgccaaggac
attgtctgggctcaggaagagcctctgaacgccggtgcttggagttacactcagccccgt
attgagaccctgctgaacgagactgagcaccacaaccgtcgccacgtcctctacgctggt
cgggccccaagtgcctccgtcgcgactggtctcaagtccgtccacgccaaggaggaacag
gacttccttcaggaagcattcactgtccaccagcatcgtctgaagggcgagtaa

DBGET integrated database retrieval system