KEGG   Nostoc flagelliforme: COO91_06204Help
Entry
COO91_06204       CDS       T05266                                 

Definition
(GenBank) ppgK, polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00010  Glycolysis / Gluconeogenesis
nfl00520  Amino sugar and nucleotide sugar metabolism
nfl01100  Metabolic pathways
nfl01110  Biosynthesis of secondary metabolites
nfl01120  Microbial metabolism in diverse environments
nfl01130  Biosynthesis of antibiotics
nfl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COO91_06204
   00520 Amino sugar and nucleotide sugar metabolism
    COO91_06204
Enzymes [BR:nfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     COO91_06204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF2993
Motif
Other DBs
NCBI-ProteinID: AUB40198
UniProt: A0A2K8SXM2
LinkDB All DBs
Position
5783197..5783913
Genome map
AA seq 238 aa AA seqDB search
MVDENGSIRTLSVDIGGSGVKAMVLDITGNPVTERARLDTPQPATPEVVINAIVVLAAAQ
GEFHRVSVGFPGVVRSGVTETAVNLHPDWIGFDLETALLKHLNKPVRVINDADMQGFGAI
AGKGVELVITLGTGFGSALFVDGKLVPNMEMGHHPFRKGETFEQQLGRAELEKIGEKRWN
KRLEKAIASLEHLFNYDYLYIGGGEAVRVNFQLPLNVKLIPNITGLLGGIALWRDEKR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgaaaacggatcgattcgtaccctatcggttgatattggcggtagtggcgtt
aaggctatggttttggatattacggggaatcctgtaacggaaagggcgcgtttagatacg
ccccaacctgctacaccggaggttgtaattaatgcaattgttgtgttagcagccgctcaa
ggtgaatttcatcgcgtttcggtcggttttcccggtgtggtgcggtctggagtcacggaa
actgcggtaaacttacatccagattggattggatttgatttggaaacagcattattaaaa
cacttaaacaagcctgtacgggtaattaatgatgcagacatgcaggggtttggagcgatc
gcaggtaaaggtgtcgaactggtgattactttgggtacggggtttggttcggctttattt
gtagatggtaagctggtgccaaatatggaaatggggcatcatccatttcgcaaaggagag
actttcgagcagcagttggggcgtgcagagttagaaaaaattggtgagaaaagatggaac
aagcgtttagaaaaagcgatcgcatccttggaacatctgttcaattatgattacctttac
attggcggcggtgaagctgtgagagtaaatttccagctaccgttaaatgtcaaactcatt
cccaatatcactggtttattaggcggtattgctttgtggcgagatgagaaaaggtaa

DBGET integrated database retrieval system