KEGG   Nocardia farcinica NCTC11134: ERS450000_01391Help
Entry
ERS450000_01391   CDS       T04524                                 

Gene name
katE
Definition
(GenBank) Catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00380  Tryptophan metabolism
nfr00630  Glyoxylate and dicarboxylate metabolism
nfr01110  Biosynthesis of secondary metabolites
nfr01130  Biosynthesis of antibiotics
nfr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nfr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ERS450000_01391 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    ERS450000_01391 (katE)
Enzymes [BR:nfr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     ERS450000_01391 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: CRY75546
UniProt: A0A0H5NZL1
LinkDB All DBs
Position
1:complement(1400074..1402233)
Genome map
AA seq 719 aa AA seqDB search
MTGHTPDTPDNAADADHAAGGADRKQRQLDAHRVDREQGHLTTQQGVRVRHTDDALSAGA
RGPTLLDDFHAREKITHFDHERIPERVVHARGAGAYGYFQPYDDRLAEYTVAKFLTDPAE
RTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTSQGNYDLVGNNFPVFFIQDGIKFPDFV
HAVKPEPHNEIPQAASAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFR
FLDAAGTPTFVKFHWTPKLGVHSLVWDECQQIAGRDPDYNRRDLWDCIEAGHYPEWELGV
QLIPVEKEFDFDFDLLDATKLVPEEQVPVLPVGRMVLDRNPDNFFAETEQVAFHTANLVP
GIDFTDDPLLQLRNFSYLDTQLIRLGGPNFAQIPINRPVADVRNHQQDGYGQHAIPRGQA
SYTVNSIGGGCPVVGGDGSYEHYPRQVDGRAQRRRAESFREYYRQPRMFWRSMSAPEAEH
IVEAFAFELGKVQRVEIRERTLGQLVRIDPDLAVRVAGRLGLPAPPPDPEAGTDAFVSPA
LSQAHTAKDGIATRQVAVLAADGVDAAGVRALRSALTERGAIVEVIASHGGMVHADGGDG
DTLPVDRTLMTVASVLYDGVVVAGGQTGVETLTRNGEAVHFVLEAFKHAKPVAAFGAGVS
LLRIAGILDAARVHEADPTTGVITTDTHGDGLDERFVADLARALANHRTWQRATSAIPA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactgggcacacccccgacacccccgacaatgccgccgacgccgaccacgccgccggc
ggagcggatcgcaagcagcgtcagctcgacgcccaccgggtcgaccgggagcagggccac
ctcaccacccagcagggcgtgcgagtgcgccacaccgacgacgcgctctcggccggcgcc
cgcggccccacgctgctcgacgacttccatgccagggagaagatcacccacttcgatcac
gagcgcatccccgaacgcgtggtgcacgcgcgcggcgccggtgcctacggctacttccag
ccctacgacgaccggctggccgaatacaccgtcgcgaagttcctgaccgatcccgccgaa
cgcaccccggtgttcgtgcgcttctccaccgtcgccggttcccgtggttcggccgacacc
gtgcgcgacgtgcgcggtttcgcgaccaagttctacacctcgcagggcaactacgacctg
gtcggcaacaacttcccggtgttcttcatccaggacggcatcaagttccccgacttcgtg
cacgcggtgaaacccgagccgcacaacgagataccgcaggccgcctcggcgcacgacacc
ctgtgggacttcgtgtcgctgcagccggagaccctgcacgcgatcatgtggctgatgtcg
gaccgggcgctgccgcgcagctaccggatgatgcagggcttcggcgtgcacaccttccgg
ttcctcgacgccgcgggcacgccgaccttcgtgaagttccactggacgcccaagctcggg
gtgcactcgctggtgtgggacgaatgccagcagatcgccgggcgcgaccccgactacaac
cgccgcgatctgtgggactgcatcgaggccgggcactatccggagtgggagctgggcgtg
cagctcatcccggtggagaaggagttcgacttcgacttcgacctgctcgacgccaccaag
ctggtccccgaggaacaggtgcccgtgctgccggtgggccggatggtgctcgaccgcaac
ccggacaacttcttcgccgagaccgagcaggtcgccttccacaccgccaacctggtgccg
ggcatcgacttcaccgacgacccgctgctgcaactgcgcaacttctcctatctggacacc
cagctgatccggctcggcggccccaacttcgcccagatcccgatcaaccgcccggtcgcc
gacgtgcgcaaccaccagcaggacggctacggccagcacgccatcccgcgcgggcaggcg
agctacaccgtcaacagcatcggcggcggctgccccgtcgtgggcggcgacggctcctac
gagcactacccgcggcaggtggacggccgggcgcagcgccggcgcgccgagagcttccgg
gagtactaccggcagccgcggatgttctggcgcagcatgtccgcaccggaggccgaacac
atcgtggaggccttcgccttcgaactcggcaaggtgcagcgggtggagatccgcgagcgc
acgctcggccagctggtgcgcatcgaccccgacctggccgtgcgggtggcgggccggctc
ggtctgcccgcgccgccgccggaccccgaggccggcaccgatgccttcgtctccccggcc
ctctcgcaagcccacaccgccaaggacggcatcgccacccggcaggtcgcggtgctggcc
gccgacggagtggacgcggcgggggtgcgggcgctgcgctcggcgctcaccgaacgcggc
gcgatcgtggaggtgatcgcctcgcacggcggcatggtgcacgccgacggcggcgacggc
gacaccctgccggtcgatcgcacgctgatgacggtggcctcggtgctctatgacggcgtc
gtggtcgccggcgggcagaccggagtggagacgctgacccgcaacggcgaggcggtgcat
ttcgtcctcgaggcgttcaagcacgccaaaccggtcgcggcgttcggtgcgggtgtctcg
ctgttgcggatcgcgggcatcctcgacgcggcgcgggtgcacgaggccgacccgaccacc
ggcgtgataaccaccgacacccacggtgacggtcttgacgagcgattcgtggccgatctg
gcgcgggcactggcgaaccatcggacgtggcagcgggcgacctcggcgattccggcataa

DBGET integrated database retrieval system