KEGG   Nocardia farcinica NCTC11134: ERS450000_03145Help
Entry
ERS450000_03145   CDS       T04524                                 

Gene name
glpD_2
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00564  Glycerophospholipid metabolism
nfr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ERS450000_03145 (glpD_2)
Enzymes [BR:nfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ERS450000_03145 (glpD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 3HCDH_N NAD_binding_8 Pyr_redox Lycopene_cycl GIDA Thi4
Motif
Other DBs
NCBI-ProteinID: CRY78853
UniProt: A0A0H5NU71
LinkDB All DBs
Position
1:complement(3246299..3248032)
Genome map
AA seq 577 aa AA seqDB search
MTKRPQSQCLGPEQRRTAWERLGKEHFDVVVVGGGVVGAGIALDAATRGLDVALVEARDL
ASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELALSTLSPHLVKPLRFLYPLTHRGW
ERPYVASGLVLYDTMGGAKSVPGQRHLTRHGALRLAPGLRRDALIGGVSYYDTVVDDARH
TMTVARTAAHYGAVIRTSTQVVGFLREADRVVGVKIRDTEDGRTGEVRAHVVINATGVWT
DEVQALSQTRGRFHVRASKGVHVVVPRDRIVSDTALILRTATSVLFVIPWGAHWIIGTTD
TDWNLDLAHPAATKADIDYLLDRVNQVLVTPLTHDDITGVYAGLRPLLAGESDSTSKLSR
EHAVARIAPGLVAIAGGKYTTYRVMAYDAVDEAAQDIPARVSPSITEKVPLLGADGYFAL
VNQTVQLAEMYGVHPYRIKHLLDRYGSLIDEVMVLAQDRPELLQPITAAPSYLRVEAVYA
AAAEGALHLDDILARRTRISIEYAHRGADCAEEVARLVAPVLGWDEAEIEREIDTYRSRV
EAEVRSQTQPDDASADALRIAAPEPRPQILEPVPSEG
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagagaccgcaatcgcagtgcctcggccccgagcagcgccgcacggcctgggag
cgactcggcaaggagcatttcgacgtggtcgtcgtgggcggcggcgtggtcggcgcgggc
atcgcgctggacgcggccacccgcggcctggacgtggcgctggtggaggcacgtgacctc
gcctccggcacgtcgagccgctcgtcgaagatgttccacggcggcctgcgctatctcgag
cagttggaattcggcctggtgcgcgaggcgctgcgcgagcgcgagctggcgctgtcgacg
ctctcgccgcacctggtgaagccgctgcggttcctctacccgctgacccatcgcggctgg
gagcggccgtacgtggcctcgggcctggtgctctacgacaccatgggcggcgccaaatcc
gttcccgggcaacgccacctgaccaggcacggcgcgctgcggctggcacccggcctgcgc
cgcgacgcgctgatcggcggggtgagctactacgacaccgtggtcgacgacgcccgccac
accatgaccgtggcgcgcaccgccgcccactacggcgcggtcatccgcacctccacccag
gtggtcgggttcctgcgggaagccgaccgggtggtcggggtgaagatccgcgacaccgag
gacgggcgcaccggcgaggtcagggcgcacgtggtgatcaacgccacgggggtgtggacc
gacgaggtgcaggcgctctcgcagacccgcggccggttccacgtgcgcgcgtccaagggt
gtgcacgtggtggtgccgcgcgaccggatcgtcagcgacaccgcgctgatcctgcgcacc
gcgacctcggtgctgttcgtcatcccgtggggcgcgcactggatcatcggcaccaccgac
accgactggaacctggatctggcgcacccggccgccaccaaggcggacatcgactacctg
ctggaccgggtgaaccaggtgctggtcaccccgctgacccacgacgacatcaccggtgtg
tacgccgggttgcgcccgctgctggccggggagagcgattcgacctccaagctgtcgcgc
gagcacgccgtggccaggatcgcgcccggcctggtggccatcgcgggcggcaagtacacc
acctaccgggtgatggcctacgacgcggtcgacgaagccgcgcaggacatcccggcgcgg
gtgtcgccctcgatcaccgagaaggtgccgctgctgggcgccgacggctatttcgcgctg
gtgaaccagaccgtgcaactcgccgagatgtacggcgtgcacccgtaccggatcaagcac
ctgctcgatcgctacggctcgctgatcgacgaggtgatggtgctggcccaggaccgcccg
gagctgttgcagccgatcaccgccgcaccgtcctatctgcgggtggaggcggtgtacgcc
gcggcggccgagggcgcgctgcacctggacgacatcctggcccggcgcacccgcatctcc
atcgagtacgcccaccgcggcgcggactgcgccgaggaggtcgcgcggctggtcgcgccg
gtgctcggctgggacgaggccgagatcgagcgcgagatcgacacctaccgctcccgggtg
gaggccgaggtccgctcgcagacccagcccgacgacgcctccgccgacgcgctgcgcatc
gccgcgcccgagccgcgcccgcagatcctcgaaccggtgccgagcgagggctga

DBGET integrated database retrieval system