KEGG   Nothobranchius furzeri (turquoise killifish): 107378515Help
Entry
107378515         CDS       T05163                                 

Gene name
setd1a
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107378515 (setd1a)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107378515 (setd1a)
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107378515 (setd1a)
   HMT complexes
    COMPASS/SET1 complex
     107378515 (setd1a)
    COMPASS/SET1 complex (yeast)
     107378515 (setd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 107378515
NCBI-ProteinID: XP_015804254
LinkDB All DBs
Position
sgr05
AA seq 2241 aa AA seqDB search
MNVMGSARRTIPLTTHIPPSTRPPIVTGYTSPYPTVLPILMTRRGWIWRAGEAFSCRMDP
DSGTESQKAVSLQWESYKLVQDPAIRRVTQKIYRYDGVHFSVPDSGFPPVGDLRDPRPRR
LWSRYTELSLPVPKFKLDEFYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEMEIL
FHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGNIIHAQLDIKGQQRQKYYDLIVNG
SYTPQTVPLGGKALADSIQPQTPTQSQPDTLEIRRRLSSELAVLAAGVQALTSGNITPCS
ADTGFSDQRIDTPPPSIAGPFTPGSSASSQGGGTPYSSRSGTPFSQDSGYTSNRHPGYNP
GPLGSGYPPQDMLPSSSSSSAVSSSVGGYKVSRYPDEQDPSVHHRCRPGYPPSYRPNEPP
CYPPYPNLGGPGPQIAHHSTMPPPPFSNQHDHLPMSDRDRERDSGGRYGPGGTGSRRSSY
HHQQDTNSSSKYHSHHSHHHSDRRDDRGYRRDSLGSRSGDHSHQRHRNHHHHSHNHHGSS
SRRRNSHDRDRDRDRDRDRDSDYSNSSDPRYNSNSYRSSSNSMSPPPSSYSAYASSKEAA
PTPPQGSDGSTRPGATGLAERGSLPSAGADKGYHADHHGALPPPPPPLPPASVIAAAVAD
TLGSLDFNQDSPAGEEQWTKPKRHPSTPPAPPKTPPPSSPVHPTIASSSNSPSSASLPHH
LSSSSSSPPPPHRDSSSPEPDSTNESLPFVYHSSSLDSRIEMLLKEQKAKFSFLASDEEE
DDDRKEDKLRAKAGERVDRRGGSGKATGEQEHIRDSGEKEHRKKEERDQDGHKGKKQGKR
GEGRKSPTVLSADTQPPSTHSPLILPPEEPQPQVSLAGTGTSQQESDQPGSADAESRTGA
HTPPFNGQSQASPHSSGEDMEISDEEEEETTTTITTTATHQQSAASGSSPSSSQAAPSQT
ADPSSSPPPDSSQHFGTSMHLPIPSYPPHLPPPPPHGYSLQPPPPPGIPPLPHMELHPEY
PPPMPHHMYDYASSMELMNQYSGGAPMSFQMQTHMLSRLQQMRMSSSNGTPGPGEAATAD
YSSYHIHSMPPPHTHHSYMDQEGSGAGAHFDQDHRYMPPHMSYPYHDPHNTQIPPPPHTG
WPPHVLPPHYPSYMPPPGYGTMLTGDGNEFSVPGEQMPMLAENPHEATVQMVLATLIQEM
KNIMQRDLNRKMVENVAFATFDEWWERKETKAKPFQTMVRGVSALRDDEKKEEKINRPRE
PLTSLVDWAKSGGMEGFSLRGALRLPSFKVKRKEPQEFEQVDMKRPRPSTPPDEDDESAD
RMPEADRRGAERDSKRRKKKPRTRKPWELDSEGEETSDGSSTEKEYEEEMGSEKDSDDEG
LSDSDDGSLSSSSEGSSSSASSSSSSSEDEEEGELVESAGPDSMDESTMDSTTEKEDDKE
NIAAAVPKMDIKKGVIKDNKGDKLTALSKHPSSPSFPRPSSPSVFVPPLKKRRKTVSFTD
ENDGKTHLPAVPLSPSSHLSGEPPVLPLKLSDSPVTVAPPSSSRPSQGIQLLPFASKPGE
GNALIVPPPGRAQDSEETKKGPFVITHTTSVKSPSKRGAGKDSPRSPAPIMICRTVQNLP
LDHASMCRMAFEEAPPPPSVKRPRGRPRTSSISASSCHSFREDDEDEEESELRLRLREQV
GASSLLQLSSASTADLSVLADVALKMDPDAGDSEETETSDEAEEQKMEGNVLSPESLALL
VSPGGVIVLLEHNYCKPPLLVAPSTSKKASSRQDSSILVPTDLNSISGVLEAPEEVIGEA
LPSRLYAGDYLPSAGELSDSDDLSHVAAAAPSPKKKHYPGKGLELEYDKSEKRKRKDKEN
LEPHHSRKQKEPAGKKQRKQKLEDSDLDEDVDVEELESGELSSSDTDNEMAEDVRKSERL
FLQEAGVTSPRRLKPVPAPELPPVKFENRSEFEQMTILYDIWNAGLDGEDLTYLKKTYEK
LLQDDHSSDWLNDTHWVTHTVTNLPNPRRKKKNTDGQLREHVTGCARSEGYYAISRKEKD
VYLDLHLPEQVIREVENVDTSGVNRVLSERRSEQRRILTVIGATAVMDSDLLKLNQLKFR
KKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADNREKRYAQQGIGSSYLFR
VDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIAVNEEITYDYKF
PLEENKIPCLCGTENCRGTLN
NT seq 6726 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgatgggcagcgccaggagaacaatcccgctcacgacacacattcccccgagt
actcgtcccccaatagtcactgggtacacgtccccgtatcccactgtacttccgatcttg
atgacccgaagagggtggatatggagagcaggcgaggctttcagctgtaggatggatcca
gacagtgggacagaatcacaaaaagctgtcagtttgcagtgggaaagctacaaactcgtt
caagaccctgccatcaggcgtgttacccagaagatttacagatatgatggagtacacttc
agtgtgcccgactctggatttcctcctgtgggagacctccgggatcctagacctcggaga
ctatggtccaggtatactgaactgtccctaccagtgccaaaattcaagcttgatgagttc
tatgtgggccccatacccctcaaagaggtgaccttcgctagactcaatgacaacatcaag
gagccattcttggcagaaatgtgtgccaagtttggtgaagtggaggagatggaaattctc
tttcatcccaaaaccagaaagcacttgggccttgccagggtgttgttcaccagcaccaga
ggggctaaggacactgtcaagcatttgcacaacacctctgtgatgggtaatatcattcat
gcacagctggatataaagggtcagcagagacagaagtactatgatctgatagtcaacggg
tcctacactcctcagacagtgcctctgggagggaaggctttggcagacagcattcagcct
caaaccccaacacagtcccaacctgacacgttggaaatcagacggaggctttccagtgag
cttgctgttctggcagcaggagtccaagcccttacatcaggaaacatcacaccatgttct
gctgatactggcttcagtgaccagcgaatagacaccccccctccatccatagctggtcct
ttcacccctggctcctctgcttcatctcaaggaggaggaactccttacagctctagatct
gggactcctttctctcaagactcaggctacaccagcaaccgacatcctggctataatcca
ggccctttgggcagtggctatcccccccaggacatgttaccatcatcatcttcatcttct
gcagtctcgtcttctgtcggaggatacaaagtatctcgttaccccgatgaacaggatcca
tcagtgcaccatcgatgtcgcccagggtaccctccatcctatcgtcccaacgagccacca
tgctaccccccctaccctaatcttggaggaccagggccccagatagcacatcactccaca
atgcctcccccacctttttccaatcagcatgaccatcttccaatgtcagatcgagaccgt
gaaagagactcaggggggaggtatggaccagggggcactggctccagaaggtcatcctac
catcaccagcaggacacaaactcttcctcaaagtaccattcccatcactcccatcaccat
tcagaccgcagagatgatcggggttaccggcgcgacagcctcggctcccggtcaggtgac
cacagccaccagagacaccgcaaccaccaccaccactctcacaaccaccacggaagcagc
agtcgcagaagaaacagccacgatcgggacagggaccgagacagagatagggaccgagac
agcgactactccaacagctctgatcccagatacaattccaactcttatcgctcctcttcg
aacagcatgtctcctcctccatcatcttactctgcctacgcctcctctaaagaggctgct
ccaacccctcctcagggatcggacgggtccacccgcccaggggcaacaggccttgcagaa
aggggttctctgccttcagcaggtgctgacaaaggctaccacgccgatcatcacggtgcc
ctgcctcctcctccccctccacttccacccgcctctgttattgcggcagctgtcgctgac
acgctaggatcactggacttcaaccaggacagtcctgctggtgaagagcagtggacaaag
cccaaacgtcatcctagcactccacctgctccacccaagactcccccaccctcatctcct
gtccaccctactatcgcctcctcctctaactctccctcctcggcctcccttcctcatcac
ctttcctcctcctccagctccccaccgcctcctcaccgggactcctcttccccagaaccc
gactccactaatgagagtttaccgtttgtttaccacagcagcagtcttgactctcgcatt
gagatgctcttaaaagagcaaaaggcgaaattttctttcctcgcctctgatgaggaagag
gatgacgataggaaagaagacaagcttcgagccaaagctggggagcgagtcgatcgaaga
ggtgggtcaggtaaagcaacaggggaacaggagcacataagagacagtggagagaaagaa
cacaggaagaaagaggagcgagatcaagatggccacaaaggaaagaaacaggggaagagg
ggagaggggaggaagagcccaactgttctctcagcagatacacaacccccctccactcat
tctccccttatcctacctccagaagaacctcaaccccaggttagccttgctgggaccggg
acgtcacaacaagagtccgatcagccgggttctgctgatgcagagagccgaacgggagct
cacacaccaccctttaatgggcagagtcaggcctctcctcattcttctggggaggacatg
gagatctcagacgaggaggaggaggaaacaacaaccactataacaacaacagcaacccat
cagcaatcagccgcttcgggatcttcaccgtcctcttctcaggctgcaccgtcacaaaca
gcagacccctcgtcctccccaccacccgactcttcgcagcactttggcacttctatgcac
ctcccaataccttcctacccacctcatttacctccccctccccctcatggttactccctt
cagcctccgcctccaccagggattcccccccttccccacatggagctgcaccctgagtat
ccccctcctatgcctcaccacatgtatgactacgccagctcgatggaactgatgaaccag
tacagtggtggagcaccgatgtccttccaaatgcagacacacatgctaagtcgcttacag
cagatgcgtatgtcttcatccaacggcacaccaggtccaggtgaggccgctactgcagac
tactcatcctaccatattcactcaatgccacctcctcacacgcatcactcctacatggac
caggaggggagtggggcaggtgctcattttgaccaagaccacaggtacatgccccctcat
atgtcctatccctaccacgatccccacaatactcagataccaccccctccccacactggc
tggccaccacacgtcttacctcctcattacccctcctacatgccccctcctggctacggc
actatgctgaccggagatgggaacgagtttagcgttcccggggagcagatgcccatgttg
gctgagaatccacatgaggcaacggtgcagatggtcttggccacgcttatccaggaaatg
aagaacatcatgcagagggacctaaaccgtaagatggtggagaacgtagcgtttgcaacg
tttgatgagtggtgggagaggaaggagaccaaagccaagcctttccagactatggtaagg
ggagtgtctgctttacgggatgatgagaaaaaggaggaaaagatcaatcgtccacgggag
ccccttacgtctcttgtggattgggcaaagagcggtggcatggagggcttttctcttaga
ggagctcttcgattaccctcctttaaggtgaaaaggaaagaacctcaggagtttgaacag
gtggacatgaagaggcctcggccatcaactcctccagatgaagatgacgaatctgcagac
aggatgccagaggcagacaggcgcggagctgaaagggacagcaagaggagaaagaagaag
ccaagaactcgtaaaccttgggaactcgacagtgagggagaagaaacatctgatggctcg
tcaactgaaaaggagtatgaggaagaaatgggcagtgagaaggattctgatgatgaaggc
ctcagtgacagtgatgacgggagtctctcttcgtcttctgaaggctcctcttcttcagca
tcatcatcttcatcctcgtctgaagatgaagaggagggagagctggtggaaagtgccggt
ccagactccatggatgagtcgaccatggacagcacaaccgagaaggaggatgacaaagaa
aatattgctgctgcagttccaaagatggacatcaaaaaaggtgttataaaagacaacaag
ggggataaactgacagcactgtccaagcatccttcatctccttccttcccgcggccttca
tcccccagtgtttttgtgccccccctcaagaaacgcagaaagaccgtgtcattcacagac
gagaatgatggcaaaacacacctgcctgctgtgccactgtctccatcttcacatttgtcg
ggtgaaccccctgtcctccctctcaagctttcagactctcccgtcactgttgcgccgccc
tcctcgagtcgccccagtcaaggaatccagcttctgcctttcgcctcaaaaccaggagaa
ggcaatgccctcattgtcccccctcctggacgagcccaggattcagaggagaccaaaaag
ggaccttttgttatcacgcacacaacttctgtcaagtctcccagcaaacggggagcaggc
aaagactctcccagatctcccgcccctattatgatatgccgcacggtgcagaaccttcca
ttggaccatgcttctatgtgtaggatggcctttgaggaggcccctccaccaccttctgtc
aagcggcccagaggcagacctcggacatccagcatttctgcttcttcctgtcactccttc
agagaggatgacgaggatgaggaggaaagtgagctaaggttaagacttagagagcaggtg
ggagcttccagcctcctgcagctgtcctcggcctccacagctgacctgtctgtgctggct
gatgtagccttaaaaatggacccagatgctggggactctgaggagacagaaacttctgat
gaagcagaagagcagaaaatggaaggaaatgtcctctctccagagtcgctggctttgctt
gtaagtcctggaggtgttatcgtccttttggagcacaactactgcaaacctcctttactc
gtagcaccatccacttccaaaaaggcttcctctagacaagattcctccatcttagtcccg
acagacctcaattctatttctggggtccttgaggctccagaggaagtgattggagaggcg
ttaccgtccaggttgtatgctggagactacctgccttcagcgggagagctgagtgattct
gatgatctgagccacgtggcagctgcagcgccatctccaaagaagaaacattatcctggg
aaaggtttagaacttgaatatgacaagagtgaaaagaggaagagaaaagataaagaaaac
cttgagccacaccattcacggaagcagaaggagccggcaggcaagaagcagaggaagcag
aaactagaggattctgacttagatgaagatgtggacgtggaggagcttgaatctggggag
ctctccagctcagacactgataacgagatggcagaagacgtgaggaagagcgaacgcctc
tttctgcaggaggcgggggtgacttcgccacgcaggctgaagcctgttcctgcacctgag
ctgccacctgttaagtttgaaaaccgtagtgaatttgaacaaatgaccatcttgtatgac
atctggaatgctggtctggatggtgaagacttgacctacctgaagaagacttatgagaag
ctgttacaggacgaccacagctccgactggctcaacgatactcactgggtcactcatact
gtaaccaatttaccaaaccctcgacgcaaaaagaagaacacagatggacagcttcgagag
catgtgactggatgtgccaggagtgagggttactacgccatcagccgcaaggagaaggac
gtctacctagacctgcatcttcccgagcaggtcatacgggaagttgagaatgtcgatacc
tcaggagttaaccgtgtgctatcagagaggcgttcagagcagcgccgcatcctcacagtc
attggagccacagctgtcatggactctgatctacttaaactcaaccagcttaagttccga
aagaagaagcttcgttttgggcgcagtcgaatccacgagtggggtttgttcgccatggag
cccatcgctgctgatgagatggttattgagtatgttggtcaaaacatcagacagatggtg
gctgacaatcgagaaaagcggtacgcacagcagggcatcgggagcagctacttgttcaga
gtggaccacgacacaataatagatgcgaccaagtgtggcaacctggcccgattcatcaac
cactgctgcactccaaactgctatgccaaggttatcaccatagagtcccagaagaagatt
gtgatctactcaaagcaacctattgcagtgaatgaagaaatcacctatgactataaattc
cctctggaggagaacaagatcccgtgtctgtgtggaacagaaaactgtcgcgggacactc
aactag

DBGET integrated database retrieval system