KEGG   Nothobranchius furzeri (turquoise killifish): 107379678Help
Entry
107379678         CDS       T05163                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107379678
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107379678
Peptidases [BR:nfu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107379678
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107379678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
sgr05
AA seq 246 aa AA seqDB search
MIAIVFVLLGAAAAAPVDDRIVGGYQCKAHSQPWQVSLNIGYHFCGGSLINDQWIISAAH
CWQNPFSQIAVLGDNHIWMHEGTEQYMSVDAIYWHASYDYTTLDYDIMLMKLAHPVTLNN
HVKPIPLPKACPTPGDMCTVSGWGNIYSDDVFNPFYLQCVEVPILSHKDCDASYPGMITE
RMVCAGYPEGGKDACQGDSGGPLVCNGELQGIVSWGQGCAQPNYPGVYTKVCSLLPWINE
TLSRYS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccatcgtttttgtgctcctgggagctgcagctgcagcacctgtggacgacaga
attgtgggaggctaccagtgcaaagcccactctcaaccctggcaggtgtccctgaacatc
ggctaccacttctgtggcggctccctcattaatgaccagtggatcatctctgctgcccat
tgctggcaaaaccctttttcacagattgccgtcttgggtgacaaccacatctggatgcac
gaaggcactgagcagtacatgtcagtggatgccatctactggcacgccagttacgactac
accaccctggactatgacatcatgctgatgaagctggctcatcctgtcactctgaacaat
catgtcaaacccatccctcttcccaaagcctgtcctacaccaggggacatgtgcacggta
tctggatgggggaacatttattctgatgatgtgttcaacccattttaccttcagtgtgtg
gaggttcccatcttgtcccataaggactgtgatgcttcctaccctggaatgattacagag
cgcatggtgtgtgctggatacccggagggaggcaaggatgcctgtcagggcgactccggc
ggccctctggtgtgtaacggggagctgcagggaatcgtgtcttggggtcagggctgtgct
cagcctaactacccaggggtctacaccaaagtctgttctctgctgccctggatcaatgag
actctttctagatacagctag

DBGET integrated database retrieval system