KEGG   Nothobranchius furzeri (turquoise killifish): 107383562Help
Entry
107383562         CDS       T05163                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00500  Starch and sucrose metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107383562
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107383562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 107383562
NCBI-ProteinID: XP_015811771
LinkDB All DBs
Position
sgr09
AA seq 512 aa AA seqDB search
MKLIILVALFGLGFTQHDPNIKDGRTAIVHLFEWRWADIAAECERFLGPNGFGGVQISPP
NEHIVINNPWRPWWQRYQPIGYNLCSRSGSEDELREMITRCNNVGVNIYVDAVINHMCGA
GGGEGTHSSCGSWFSASKQDFPSVPYSNWDFNGNKCKTASGDIENYGDPYQVRDCRLVSL
LDLALEKDYVRGKVADFMNKLIDMGVAGFRVDACKHMWPGDLDNVYRRLHNLNTKWFPNG
SRPFIFQEVIDLGGEPISSKEYFSLGRVTEFKYGAKLGTVFRKWNGEKLHYTRNWGEGWG
FMPDGNALVFVDNHDNQRGHGAGGASIITFWDSRLYKMAVGYMLAHPYGVARVMSSFRWD
RHIVNGKDQNDWMGPPSNSDGSTKPVPINPDQTCGDGWVCEHRWRQIKNMVIFRNVVNGQ
PHSNWWDNQSNQVAFGRGDRGFIIFNNDDWDLDVTLNTGMPAGTYCDVISGQKEGNSCTG
KQIQVGNDGRAHFRISNSDEDPFVAIHAQSKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatcatcctggttgctttgtttgggcttggctttacccagcatgaccccaat
atcaaggacggaaggaccgccatcgtccatctgtttgagtggcgctgggctgacattgct
gcagagtgtgagcgctttctgggtcccaatggttttggtggagttcagatttctcctcca
aatgaacacattgtgataaacaatccctggaggccctggtggcagagataccagcccatt
ggctacaacctgtgctccagatctggcagtgaagatgaactgagggaaatgatcaccaga
tgcaacaatgttggggttaacatctatgtggatgctgtcataaaccacatgtgtggagca
ggcggtggagaaggaactcactcttcatgtggaagctggttcagtgccagcaaacaggac
ttccccagtgtgccgtattccaactgggacttcaacggcaacaaatgcaaaactgccagc
ggtgacattgagaactatggagacccttatcaggtgcgcgactgtcgtcttgttagtctg
ttggatctcgcccttgagaaagattacgtcaggggcaaagtagctgacttcatgaacaag
ctgattgacatgggtgtggctggattcagagtggatgcctgcaagcacatgtggcccggt
gacctggataacgtttaccgtcgtcttcacaacctcaacaccaagtggttccccaatggc
tccaggcctttcatcttccaggaggtcattgatctgggaggtgagcccatttcatccaag
gaatatttctctctgggaagagtgactgagttcaaatatggagccaaactgggaactgtc
ttcaggaaatggaatggtgaaaagcttcattacaccaggaactggggagaaggatggggc
tttatgcctgatggcaatgcacttgtgtttgttgataaccacgacaaccagagaggtcac
ggtgcaggtggtgcatccatcattaccttctgggactccagactctacaagatggctgtt
ggctacatgctggctcatccctatggagtagccagagtcatgtccagcttccgatgggat
cgtcacattgtcaatggaaaagatcaaaatgactggatgggccctcccagcaacagtgat
gggtccaccaagcctgttcccatcaaccctgaccagacctgtggagacggatgggtgtgt
gagcaccgatggcgtcagatcaagaacatggtcattttccgtaatgtggtcaacggacag
ccccacagcaactggtgggacaaccagagcaatcaggtggcttttgggcgtggtgatcgt
ggtttcatcatcttcaataatgatgactgggacctagacgtgaccttgaacacgggtatg
ccagctggaacctactgcgatgtcatttcaggccagaaagaaggaaacagctgcactgga
aaacagatccaagttggaaacgatggccgtgctcacttcaggatcagcaacagtgatgaa
gaccctttcgttgcaatccatgcacaatccaagctgtaa

DBGET integrated database retrieval system