KEGG   Nothobranchius furzeri (turquoise killifish): 107384224Help
Entry
107384224         CDS       T05163                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
Enzymes [BR:nfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107384224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 107384224
NCBI-ProteinID: XP_015812838
UniProt: A0A1A7ZNB0
LinkDB All DBs
Position
sgr09
AA seq 781 aa AA seqDB search
MPGERLTLRSTSEIGRFPGAAPPTRVQVTIHNENEKQEEGGCRRWFRKICPCCCKRKNST
SYDVTDKVELTKVPAPTPEPTKPKPENGERKETEGVELSVCSVDLLSSGLGQNRVEHHTD
QFHGDELIIRRGQTFQIEIELSRPFSAETDKMHLELKTGFLPKVSKGTHVIIPLVEHLED
ERWEAKITEQNGTKIKLSVNSPANAVIGLYGLSVITGSLKDEAPTTHSSSKNIVMLFNPW
CEEDTVFMDDDDQRKEYVLNDTGRIYYGTEKQIGARTWNFGQFHEGILEACLFVLEKSDM
PPSGRGDPVNVVRVISAMINAQDDYGVLVGNWSGNYSDGVSPAAWSSSVEILRKYHSSEG
IPVSYGQCWVFSGVTTTVLRCLGIPARSVTNFQSAHDTDVSLTTDVYFDENLQPIDHLNS
DSVWNFHVWNDCWMARPDLPPGHGGWQAVDSTPQETSQGIFCCGPASVSAIRSGQVYLKH
DTPFVFAEVNSDKIYWQRNLDGTFSQIYSEKKAVGHCISTKAVGSDERDDITQLYKHPED
SEEERIAVETASRYGSKPDVYSAPAAEDVQVEVKIDGEGPRMGSDAKLSIVMKNLSSKAR
RATLHSQVAVMHYTGVLKNAIKKDQIPVELLPNEEKTIEWVLPYQQYQNQLMDQAALMLT
LCGRVSETKQVLANQTSFRLRTPDLKILPLGDAVVGKEMSAKITFTNPLPRMLKDVVFRV
EGLGLQKGHEVVVGDVGGHSTVTLTEHFIPSQPGPRKLVASLDCKQLTQVHGVADITVLE
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgagaggttgacactgagaagcacatctgaaattgggcgtttccctggtgca
gccccgcccactagggtgcaggtcaccattcacaacgagaacgagaagcaggaggaggga
ggctgtcgccggtggttcaggaagatctgtccgtgctgctgtaaacgcaaaaacagcaca
tcctatgatgtcacagataaggtagaactgaccaaagtcccagcaccaaccccagagcct
accaaacccaaacctgagaatggagaaaggaaagagactgaaggagtggagctgtcagtc
tgctccgtggacctcctaagctctggattgggtcagaatagagtggagcatcacacggat
cagtttcatggggatgagctgatcatccgccgtggacagaccttccagatcgagatagag
ctcagccggcctttcagtgctgaaactgacaagatgcacctggagttgaaaacaggtttc
ctgcccaaagtgtccaaagggacccatgttatcattccgctggtggagcacctggaggat
gaacgctgggaggccaagatcacggagcagaacggcactaagatcaagctgtctgtgaac
tctccagccaacgcggttatcggcctgtatgggctctctgtgatcaccgggtccctgaag
gacgaggctccgaccactcacagctccagcaagaacattgtcatgctgttcaacccttgg
tgtgaagaggacaccgtgttcatggatgacgacgatcagaggaaggagtatgtgctgaac
gacacggggaggatttactacggaacagagaagcaaattggtgctcgcacgtggaacttt
gggcagtttcatgagggaatcctggaagcatgtctgtttgtcctggagaaaagtgacatg
cctccatctgggcgaggtgaccccgtcaatgtggtcagagtcatttctgctatgataaat
gctcaggatgattatggcgttctggttgggaactggtcagggaattactctgatggcgtc
tctcccgcggcatggagcagcagtgtggagatcctgagaaaataccactccagcgaagga
atcccagtgagttacgggcagtgctgggtcttctcaggggtcaccacgacagtgctgcgc
tgtctcggcatacctgctcggagtgtgaccaactttcagtctgcacatgacacagatgtt
tccctcactacagatgtgtactttgatgagaatctgcagccaatcgatcacctcaatagt
gactctgtctggaacttccatgtttggaatgattgctggatggccagaccagacttgcct
cctggtcatggagggtggcaggctgttgactccactccccaggagacgagtcagggcatt
ttctgctgtggccccgcctccgtcagcgctatccgctctggtcaagtttacctcaaacat
gacacgccattcgtctttgctgaggtgaacagtgataagatctactggcagaggaatcta
gacgggacattcagccagatctacagcgagaagaaagctgtcggccactgcatcagcacc
aaagcagtcggctcggatgaacgagatgacatcacacagctgtacaaacacccagaagat
tcggaggaggaacgcattgccgtggagaccgcgagtcgttatggcagcaagccagatgtg
tactctgctcctgcagcagaggacgttcaagtggaggtgaagatagatggtgaggggccc
aggatgggcagtgacgccaagctgagcattgtgatgaagaacctgagctccaaggcccgg
cgggcgactctgcacagccaggtggccgtcatgcactacaccggtgtgctgaagaatgct
atcaagaaggatcagatacctgtggagctgttgcccaatgaagaaaagactattgagtgg
gtcttaccctaccagcagtaccagaaccagctaatggaccaggcagcgctgatgctaact
ctgtgtgggagagtctctgagaccaagcaggtgttagccaaccagacatctttcaggctc
cgaacgcctgacctcaagatcctgcctctgggtgacgctgtggttggtaaagagatgtca
gccaagatcaccttcaccaacccgctgccacgcatgctaaaggacgtggtgtttagagtg
gagggtctgggtctgcagaaaggccatgaagtggtcgtaggtgatgttggcggccactcc
acagtgacactgacggagcacttcatcccctcccagcccggacccaggaagctggtcgcg
tccctcgactgtaaacaactcactcaagtgcacggagtggctgacattactgttcttgag
cagtga

DBGET integrated database retrieval system